Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQC0H27)

DOT Name	Cancer/testis antigen 55 (CT55)
Synonyms	Tumor antigen BJ-HCC-20
Gene Name	CT55
Related Disease	Familial prostate carcinoma ( ) Advanced cancer ( ) Astrocytoma ( ) Breast cancer ( ) Breast carcinoma ( ) Colitis ( ) Colorectal carcinoma ( ) Fanconi anemia complementation group A ( ) Fanconi's anemia ( ) Head-neck squamous cell carcinoma ( ) Neoplasm ( ) Testicular cancer ( ) Hereditary breast carcinoma ( ) Spermatogenic failure, X-linked, 7 ( )
UniProt ID	CT55_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF14444
Sequence	MLRLLRLALAFYGRTADPAERQGPQQQGLPQGDTQLTTVQGVVTSFCGDYGMIDESIYFS SDVVTGNVPLKVGQKVNVVVEEDKPHYGLRAIKVDVVPRHLYGAGPSDSGTRVLIGCVTS INEDNIYISNSIYFSIAIVSEDFVPYKGDLLEVEYSTEPGISNIKATSVKPIRCIHTEEV CITSVHGRNGVIDYTIFFTLDSVKLPDGYVPQVDDIVNVVMVESIQFCFIWRAISITPVH KSSSGFQDDGGLGRPKRERRSQSI
Function	Plays a role in spermatogenesis, possibly acting in the regulation of the autophagy pathway.
Tissue Specificity	Testis-specific . Expressed in spermatozoa (at protein level) .

Molecular Interaction Atlas (MIA) of This DOT

14 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Familial prostate carcinoma	DISL9KNO	Definitive	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Astrocytoma	DISL3V18	Strong	Biomarker	[3]
Breast cancer	DIS7DPX1	Strong	Biomarker	[4]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[4]
Colitis	DISAF7DD	Strong	Biomarker	[2]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[2]
Fanconi anemia complementation group A	DIS8PZLI	Strong	Biomarker	[5]
Fanconi's anemia	DISGW6Q8	Strong	Biomarker	[5]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Altered Expression	[6]
Neoplasm	DISZKGEW	Strong	Altered Expression	[6]
Testicular cancer	DIS6HNYO	Strong	Biomarker	[2]
Hereditary breast carcinoma	DISAEZT5	moderate	Genetic Variation	[7]
Spermatogenic failure, X-linked, 7	DIS8T866	Limited	Unknown	[8]
------------------------------------------------------------------------------------


⏷ Show the Full List of 14 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Cancer/testis antigen 55 (CT55).	[9]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Cancer/testis antigen 55 (CT55).	[10]
------------------------------------------------------------------------------------

References

1	Analysis of the gene coding for the BRCA2-interacting protein PALB2 in hereditary prostate cancer.Prostate. 2008 May 1;68(6):675-8. doi: 10.1002/pros.20729.
2	Cancer testis antigen 55 deficiency attenuates colitis-associated colorectal cancer by inhibiting NF-B signaling.Cell Death Dis. 2019 Apr 3;10(4):304. doi: 10.1038/s41419-019-1537-x.
3	Alterations of BCCIP, a BRCA2 interacting protein, in astrocytomas.BMC Cancer. 2009 Aug 4;9:268. doi: 10.1186/1471-2407-9-268.
4	APRIN is a cell cycle specific BRCA2-interacting protein required for genome integrity and a predictor of outcome after chemotherapy in breast cancer.EMBO J. 2012 Mar 7;31(5):1160-76. doi: 10.1038/emboj.2011.490. Epub 2012 Jan 31.
5	Fanconi anemia is associated with a defect in the BRCA2 partner PALB2.Nat Genet. 2007 Feb;39(2):159-61. doi: 10.1038/ng1942. Epub 2006 Dec 31.
6	A Comprehensive Expression Analysis of Cancer Testis Antigens in Head and Neck Squamous Cell Carcinoma Revels MAGEA3/6 as a Marker for Recurrence.Mol Cancer Ther. 2015 Mar;14(3):828-34. doi: 10.1158/1535-7163.MCT-14-0796. Epub 2015 Jan 6.
7	Contribution of inherited mutations in the BRCA2-interacting protein PALB2 to familial breast cancer.Cancer Res. 2011 Mar 15;71(6):2222-9. doi: 10.1158/0008-5472.CAN-10-3958. Epub 2011 Feb 1.
8	Deficiency of cancer/testis antigen gene CT55 causes male infertility in humans and mice. Cell Death Differ. 2023 Feb;30(2):500-514. doi: 10.1038/s41418-022-01098-6. Epub 2022 Dec 8.
9	Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
10	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.