Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQJHICM)

• DOT Name: Transcription factor LBX1 (LBX1)
• Synonyms: Ladybird homeobox protein homolog 1
• Gene Name: LBX1
• Related Disease:
  Androgen insensitivity syndrome
  Adult T-cell leukemia/lymphoma
  Autism spectrum disorder
  Bipolar disorder
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  T-cell leukaemia
  Fetal growth restriction
  Acute myelogenous leukaemia
• UniProt ID: LBX1_HUMAN
• Pfam ID: PF00046
• Sequence:
  MTSKEDGKAAPGEERRRSPLDHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLL
  AAADKHAQGGLPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQ
  TPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKL
  KRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEATAGGGGGCGRAKSRPGSPVLPPG
  APKAPGAGALQLSPASPLTDQPASSQDCSEDEEDEEIDVDD
• Function: Transcription factor required for the development of GABAergic interneurons in the dorsal horn of the spinal cord and migration and further development of hypaxial muscle precursor cells for limb muscles, diaphragm and hypoglossal cord.

Molecular Interaction Atlas (MIA) of This DOT

10 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Androgen insensitivity syndrome	DISUZBBO	Definitive	Biomarker	[1]
Adult T-cell leukemia/lymphoma	DIS882XU	Strong	Biomarker	[2]
Autism spectrum disorder	DISXK8NV	Strong	Genetic Variation	[3]
Bipolar disorder	DISAM7J2	Strong	Biomarker	[4]
Breast cancer	DIS7DPX1	Strong	Biomarker	[5]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[5]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[5]
T-cell leukaemia	DISJ6YIF	Strong	Genetic Variation	[2]
Fetal growth restriction	DIS5WEJ5	moderate	Altered Expression	[6]
Acute myelogenous leukaemia	DISCSPTN	Limited	Genetic Variation	[7]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Transcription factor LBX1 (LBX1).	[8]

References

• [1] Paraspinal muscle ladybird homeobox 1 (LBX1) in adolescent idiopathic scoliosis: a cross-sectional study.Spine J. 2019 Dec;19(12):1911-1916. doi: 10.1016/j.spinee.2019.06.014. Epub 2019 Jun 14.
• [2] Genetic mapping of two mouse homeobox genes Tlx-1 and Tlx-2 to murine chromosomes 19 and 6.Genomics. 1994 Nov 15;24(2):388-90. doi: 10.1006/geno.1994.1634.
• [3] Common genetic variation in the GAD1 gene and the entire family of DLX homeobox genes and autism spectrum disorders.Am J Med Genet B Neuropsychiatr Genet. 2011 Mar;156(2):233-9. doi: 10.1002/ajmg.b.31148. Epub 2010 Dec 16.
• [4] Decreased thalamic expression of the homeobox gene DLX1 in psychosis.Arch Gen Psychiatry. 2003 Sep;60(9):869-74. doi: 10.1001/archpsyc.60.9.869.
• [5] A developmentally regulated inducer of EMT, LBX1, contributes to breast cancer progression.Genes Dev. 2009 Aug 1;23(15):1737-42. doi: 10.1101/gad.1809309.
• [6] EG-VEGF controls placental growth and survival in normal and pathological pregnancies: case of fetal growth restriction (FGR).Cell Mol Life Sci. 2013 Feb;70(3):511-25. doi: 10.1007/s00018-012-1141-z. Epub 2012 Sep 2.
• [7] Fusion of the NUP98 gene and the homeobox gene HOXC13 in acute myeloid leukemia with t(11;12)(p15;q13).Genes Chromosomes Cancer. 2003 Jan;36(1):107-12. doi: 10.1002/gcc.10139.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.