Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTR77NZD)

• DOT Name: Acylphosphatase-1 (ACYP1)
• Synonyms: EC 3.6.1.7; Acylphosphatase, erythrocyte isozyme; Acylphosphatase, organ-common type isozyme; Acylphosphate phosphohydrolase 1
• Gene Name: ACYP1
• UniProt ID: ACYP1_HUMAN
• PDB ID: 2K7J; 2K7K; 2VH7; 2W4C; 2W4P; 3TOQ; 6CBU
• EC Number: 3.6.1.7
• Pfam ID: PF00708
• Sequence:
  MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVR
  HMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK
• Tissue Specificity: Organ-common type isozyme is found in many different tissues.
• KEGG Pathway:
  Pyruvate metabolism (hsa00620)
  Metabolic pathways (hsa01100)

Molecular Interaction Atlas (MIA) of This DOT

19 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Acylphosphatase-1 (ACYP1).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Acylphosphatase-1 (ACYP1).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Acylphosphatase-1 (ACYP1).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate affects the expression of Acylphosphatase-1 (ACYP1).	[4]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of Acylphosphatase-1 (ACYP1).	[5]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Acylphosphatase-1 (ACYP1).	[6]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Acylphosphatase-1 (ACYP1).	[2]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Acylphosphatase-1 (ACYP1).	[7]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Acylphosphatase-1 (ACYP1).	[8]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Acylphosphatase-1 (ACYP1).	[9]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Acylphosphatase-1 (ACYP1).	[10]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Acylphosphatase-1 (ACYP1).	[11]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Acylphosphatase-1 (ACYP1).	[12]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Acylphosphatase-1 (ACYP1).	[13]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Acylphosphatase-1 (ACYP1).	[14]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Acylphosphatase-1 (ACYP1).	[15]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Acylphosphatase-1 (ACYP1).	[16]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Acylphosphatase-1 (ACYP1).	[11]
Resorcinol	DMM37C0	Investigative	Resorcinol increases the expression of Acylphosphatase-1 (ACYP1).	[17]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Identification of novel low-dose bisphenol a targets in human foreskin fibroblast cells derived from hypospadias patients. PLoS One. 2012;7(5):e36711. doi: 10.1371/journal.pone.0036711. Epub 2012 May 4.
• [6] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [7] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [8] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [9] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [10] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [11] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [12] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [13] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [14] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [15] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [16] Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.
• [17] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.