Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRQJYL6)

• DOT Name: Cytochrome c oxidase assembly factor 7 (COA7)
• Synonyms: Beta-lactamase hcp-like protein; Respiratory chain assembly factor 1; Sel1 repeat-containing protein 1
• Gene Name: COA7
• Related Disease:
  Attention deficit hyperactivity disorder
  Cytochrome-c oxidase deficiency disease
  Hereditary hemophagocytic lymphohistiocytosis
  Language disorder
  Spinocerebellar ataxia, autosomal recessive, with axonal neuropathy 3
• UniProt ID: COA7_HUMAN
• PDB ID: 7MQZ
• Pfam ID: PF08238
• Sequence:
  MAGMVDFQDEEQVKSFLENMEVECNYHCYHEKDPDGCYRLVDYLEGIRKNFDEAAKVLKF
  NCEENQHSDSCYKLGAYYVTGKGGLTQDLKAAARCFLMACEKPGKKSIAACHNVGLLAHD
  GQVNEDGQPDLGKARDYYTRACDGGYTSSCFNLSAMFLQGAPGFPKDMDLACKYSMKACD
  LGHIWACANASRMYKLGDGVDKDEAKAEVLKNRAQQLHKEQQKGVQPLTFG
• Function: Required for assembly of mitochondrial respiratory chain complex I and complex IV.
• KEGG Pathway: Thermogenesis (hsa04714)

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Attention deficit hyperactivity disorder	DISL8MX9	Strong	Biomarker	[1]
Cytochrome-c oxidase deficiency disease	DISK7N3G	Strong	Genetic Variation	[2]
Hereditary hemophagocytic lymphohistiocytosis	DISQP21Z	Strong	Biomarker	[1]
Language disorder	DISTLKP7	Strong	Biomarker	[3]
Spinocerebellar ataxia, autosomal recessive, with axonal neuropathy 3	DISB4BKE	Strong	Autosomal recessive	[4]

19 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Cytochrome c oxidase assembly factor 7 (COA7).	[5]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Cytochrome c oxidase assembly factor 7 (COA7).	[6]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Cytochrome c oxidase assembly factor 7 (COA7).	[7]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Cytochrome c oxidase assembly factor 7 (COA7).	[8]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Cytochrome c oxidase assembly factor 7 (COA7).	[9]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Cytochrome c oxidase assembly factor 7 (COA7).	[10]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Cytochrome c oxidase assembly factor 7 (COA7).	[11]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Cytochrome c oxidase assembly factor 7 (COA7).	[12]
Etoposide	DMNH3PG	Approved	Etoposide decreases the expression of Cytochrome c oxidase assembly factor 7 (COA7).	[8]
Mitomycin	DMH0ZJE	Approved	Mitomycin decreases the expression of Cytochrome c oxidase assembly factor 7 (COA7).	[8]
Colchicine	DM2POTE	Approved	Colchicine decreases the expression of Cytochrome c oxidase assembly factor 7 (COA7).	[8]
Hydroxyurea	DMOQVU9	Approved	Hydroxyurea decreases the expression of Cytochrome c oxidase assembly factor 7 (COA7).	[8]
Adenine	DMZLHKJ	Approved	Adenine decreases the expression of Cytochrome c oxidase assembly factor 7 (COA7).	[8]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Cytochrome c oxidase assembly factor 7 (COA7).	[13]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Cytochrome c oxidase assembly factor 7 (COA7).	[14]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Cytochrome c oxidase assembly factor 7 (COA7).	[15]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Cytochrome c oxidase assembly factor 7 (COA7).	[16]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Cytochrome c oxidase assembly factor 7 (COA7).	[17]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Cytochrome c oxidase assembly factor 7 (COA7).	[18]

References

• [1] Auditory processing and neuropsychological profiles of children with functional hearing loss.Int J Pediatr Otorhinolaryngol. 2018 Nov;114:51-60. doi: 10.1016/j.ijporl.2018.07.054. Epub 2018 Jul 31.
• [2] Inhibition of proteasome rescues a pathogenic variant of respiratory chain assembly factor COA7.EMBO Mol Med. 2019 May;11(5):e9561. doi: 10.15252/emmm.201809561.
• [3] Intelligibility of degraded speech and the relationship between symptoms of inattention, hyperactivity/impulsivity and language impairment in children with suspected auditory processing disorder.Int J Pediatr Otorhinolaryngol. 2017 Oct;101:178-185. doi: 10.1016/j.ijporl.2017.08.010. Epub 2017 Aug 12.
• [4] COA7 (C1orf163/RESA1) mutations associated with mitochondrial leukoencephalopathy and cytochrome c oxidase deficiency. J Med Genet. 2016 Dec;53(12):846-849. doi: 10.1136/jmedgenet-2016-104194. Epub 2016 Sep 28.
• [5] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [6] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [7] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [8] Utilization of CDKN1A/p21 gene for class discrimination of DNA damage-induced clastogenicity. Toxicology. 2014 Jan 6;315:8-16. doi: 10.1016/j.tox.2013.10.009. Epub 2013 Nov 6.
• [9] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [10] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [11] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [12] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [13] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [14] Targeting MYC dependence in cancer by inhibiting BET bromodomains. Proc Natl Acad Sci U S A. 2011 Oct 4;108(40):16669-74. doi: 10.1073/pnas.1108190108. Epub 2011 Sep 26.
• [15] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [16] Isobaric tags for relative and absolute quantitation-based proteomics analysis of the effect of ginger oil on bisphenol A-induced breast cancer cell proliferation. Oncol Lett. 2021 Feb;21(2):101. doi: 10.3892/ol.2020.12362. Epub 2020 Dec 8.
• [17] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [18] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.