Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSDKQU3)

• DOT Name: Heat shock factor-binding protein 1-like protein 1 (HSBP1L1)
• Gene Name: HSBP1L1
• UniProt ID: HSBPL_HUMAN
• Pfam ID: PF06825
• Sequence:
  MDVRGPEAPGGRALRDAAENLFQELQEHFQALTATLNLRMEEMGNRIEDLQKNVKDLMVQ
  AGIENSIKEQMLKT

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Heat shock factor-binding protein 1-like protein 1 (HSBP1L1).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Heat shock factor-binding protein 1-like protein 1 (HSBP1L1).	[5]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Heat shock factor-binding protein 1-like protein 1 (HSBP1L1).	[2]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Heat shock factor-binding protein 1-like protein 1 (HSBP1L1).	[3]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Heat shock factor-binding protein 1-like protein 1 (HSBP1L1).	[4]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Heat shock factor-binding protein 1-like protein 1 (HSBP1L1).	[6]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Heat shock factor-binding protein 1-like protein 1 (HSBP1L1).	[7]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Toxicogenomics-based prediction of acetaminophen-induced liver injury using human hepatic cell systems. Toxicol Lett. 2016 Jan 5;240(1):50-9.
• [3] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [4] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [7] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.