Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSQ6J24)

• DOT Name: POTE ankyrin domain family member E (POTEE)
• Synonyms: ANKRD26-like family C member 1A; Prostate, ovary, testis-expressed protein on chromosome 2; POTE-2
• Gene Name: POTEE
• Related Disease:
  Colorectal carcinoma
  Breast cancer
  Breast carcinoma
• UniProt ID: POTEE_HUMAN
• Pfam ID: PF00022 ; PF12796 ; PF14915
• Sequence:
  MVVEVDSMPAASSVKKPFGLRSKMGKWCCRCFPCYRESGKSNVGTSGDHDDSAMKTLRSK
  MGKWCHHCFPCCRGSGKSNVGASGDHDDSAMKTLRNKMGKWCCHCFPCCRGSGKSKVGAW
  GDYDDSAFMEPRYHVRGEDLDKLHRAAWWGKVPRKDLIVMLRDTDVNKKDKQKRTALHLA
  SANGNSEVVKLLLDRRCQLNVLDNKKRTALIKAVQCQEDECALMLLEHGTDPNIPDEYGN
  TTLHYAIYNEDKLMAKALLLYGADIESKNKHGLTPLLLGVHEQKQQVVKFLIKKKANLNA
  LDRYGRTALILAVCCGSASIVSLLLEQNIDVSSQDLSGQTAREYAVSSHHHVICQLLSDY
  KEKQMLKISSENSNPEQELKLTSEEESQRFKGSENSQPEKMSQELEINKDGDREVEEEMK
  KHESNNVGLLENLTNGVTAGNGDNGLIPQRKSRTPENQQFPDNESEEYHRICELLSDYKE
  KQMPKYSSENSNPEQDLKLTSEEESQRLKGSENGQPEKRSQEPEINKDGDRELENFMAIE
  EMKKHGSTHVGFPENLTNGATAGNGDDGLIPPRKSRTPESQQFPDTENEEYHSDEQNDTQ
  KQFCEEQNTGILHDEILIHEEKQIEVVEKMNSELSLSCKKEKDVLHENSTLREEIAMLRL
  ELDTMKHQSQLREKKYLEDIESVKKKNDNLLKALQLNELTMDDDTAVLVIDNGSGMCKAG
  FAGDDAPRAVFPSIVGRPRQQGMMGGMHQKESYVGKEAQSKRGILTLKYPMEHGIITNWD
  DMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVP
  SLYTSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELPDYLMKILTERGYRF
  TTMAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEA
  LFQPCFLGMESCGIHETTFNSIMKSDVDIRKDLYTNTVLSGGTTMYPGMAHRMQKEIAAL
  APSMMKIRIIAPPKRKYSVWVGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF
• Reactome Pathway: RHOF GTPase cycle (R-HSA-9035034)

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[1]
Breast cancer	DIS7DPX1	Limited	Biomarker	[2]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[2]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of POTE ankyrin domain family member E (POTEE).	[3]

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of POTE ankyrin domain family member E (POTEE).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of POTE ankyrin domain family member E (POTEE).	[5]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of POTE ankyrin domain family member E (POTEE).	[6]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of POTE ankyrin domain family member E (POTEE).	[7]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of POTE ankyrin domain family member E (POTEE).	[9]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of POTE ankyrin domain family member E (POTEE).	[9]
Etretinate	DM2CZFA	Approved	Etretinate decreases the expression of POTE ankyrin domain family member E (POTEE).	[10]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of POTE ankyrin domain family member E (POTEE).	[11]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the expression of POTE ankyrin domain family member E (POTEE).	[11]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of POTE ankyrin domain family member E (POTEE).	[12]

2 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Quercetin	DM3NC4M	Approved	Quercetin affects the binding of POTE ankyrin domain family member E (POTEE).	[8]
Taxifolin	DMQJSF9	Preclinical	Taxifolin affects the binding of POTE ankyrin domain family member E (POTEE).	[8]

References

• [1] POTEE drives colorectal cancer development via regulating SPHK1/p65 signaling.Cell Death Dis. 2019 Nov 13;10(11):863. doi: 10.1038/s41419-019-2046-7.
• [2] Identification of ApoA1, HPX and POTEE genes by omic analysis in breast cancer.Oncol Rep. 2014 Sep;32(3):1078-86. doi: 10.3892/or.2014.3277. Epub 2014 Jun 23.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [5] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [6] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [7] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [8] Phytochemicals from Ayurvedic plants as potential medicaments for ovarian cancer: an in silico analysis. J Mol Model. 2021 Mar 25;27(4):114. doi: 10.1007/s00894-021-04736-x.
• [9] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [10] Consequences of the natural retinoid/retinoid X receptor ligands action in human breast cancer MDA-MB-231 cell line: Focus on functional proteomics. Toxicol Lett. 2017 Nov 5;281:26-34. doi: 10.1016/j.toxlet.2017.09.001. Epub 2017 Sep 5.
• [11] Comparative proteomics reveals concordant and discordant biochemical effects of caffeine versus epigallocatechin-3-gallate in human endothelial cells. Toxicol Appl Pharmacol. 2019 Sep 1;378:114621. doi: 10.1016/j.taap.2019.114621. Epub 2019 Jun 10.
• [12] Comparison of transcriptome expression alterations by chronic exposure to low-dose bisphenol A in different subtypes of breast cancer cells. Toxicol Appl Pharmacol. 2019 Dec 15;385:114814. doi: 10.1016/j.taap.2019.114814. Epub 2019 Nov 9.