Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSYWZAQ)

• DOT Name: Secretoglobin family 1D member 2 (SCGB1D2)
• Synonyms: Lipophilin-B
• Gene Name: SCGB1D2
• UniProt ID: SG1D2_HUMAN
• Pfam ID: PF01099
• Sequence:
  MKLSVCLLLVTLALCCYQANAEFCPALVSELLDFFFISEPLFKLSLAKFDAPPEAVAAKL
  GVKRCTDQMSLQKRSLIAEVLVKILKKCSV
• Function: May bind androgens and other steroids, may also bind estramustine, a chemotherapeutic agent used for prostate cancer. May be under transcriptional regulation of steroid hormones.
• Tissue Specificity: Highest expression was found in skeletal muscle. Expressed as well in thymus, trachea, kidney, steroid responsive tissues (prostate, testis, uterus, breast and ovary) and salivary gland.

Molecular Interaction Atlas (MIA) of This DOT

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Secretoglobin family 1D member 2 (SCGB1D2).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Secretoglobin family 1D member 2 (SCGB1D2).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Secretoglobin family 1D member 2 (SCGB1D2).	[3]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Secretoglobin family 1D member 2 (SCGB1D2).	[4]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Secretoglobin family 1D member 2 (SCGB1D2).	[5]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Secretoglobin family 1D member 2 (SCGB1D2).	[6]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Secretoglobin family 1D member 2 (SCGB1D2).	[7]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol increases the expression of Secretoglobin family 1D member 2 (SCGB1D2).	[8]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Secretoglobin family 1D member 2 (SCGB1D2).	[9]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Secretoglobin family 1D member 2 (SCGB1D2).	[10]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Secretoglobin family 1D member 2 (SCGB1D2).	[11]

References

• [1] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [2] Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
• [3] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [4] The organochlorine o,p'-DDT plays a role in coactivator-mediated MAPK crosstalk in MCF-7 breast cancer cells. Environ Health Perspect. 2012 Sep;120(9):1291-6. doi: 10.1289/ehp.1104296. Epub 2012 May 18.
• [5] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [6] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [7] Progesterone regulation of implantation-related genes: new insights into the role of oestrogen. Cell Mol Life Sci. 2007 Apr;64(7-8):1009-32.
• [8] The genomic response of a human uterine endometrial adenocarcinoma cell line to 17alpha-ethynyl estradiol. Toxicol Sci. 2009 Jan;107(1):40-55.
• [9] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [10] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [11] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.