Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTTAEGAN)

• DOT Name: Fatty acid-binding protein 9 (FABP9)
• Synonyms: Testis lipid-binding protein; TLBP; Testis-type fatty acid-binding protein; T-FABP
• Gene Name: FABP9
• Related Disease:
  Carcinoma
  Prostate cancer
  Prostate carcinoma
• UniProt ID: FABP9_HUMAN
• PDB ID: 4A60; 7FY1
• Pfam ID: PF00061
• Sequence:
  MVEPFLGTWKLVSSENFEDYMKELGVNFAARNMAGLVKPTVTISVDGKMMTIRTESSFQD
  TKISFKLGEEFDETTADNRKVKSTITLENGSMIHVQKWLGKETTIKRKIVDEKMVVECKM
  NNIVSTRIYEKV
• Reactome Pathway: Triglyceride catabolism (R-HSA-163560)

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Carcinoma	DISH9F1N	Definitive	Biomarker	[1]
Prostate cancer	DISF190Y	Definitive	Biomarker	[1]
Prostate carcinoma	DISMJPLE	Definitive	Biomarker	[1]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Fatty acid-binding protein 9 (FABP9).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Fatty acid-binding protein 9 (FABP9).	[5]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Fatty acid-binding protein 9 (FABP9).	[3]
Permethrin	DMZ0Q1G	Approved	Permethrin increases the expression of Fatty acid-binding protein 9 (FABP9).	[4]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Fatty acid-binding protein 9 (FABP9).	[6]

References

• [1] The increased expression of fatty acid-binding protein 9 in prostate cancer and its prognostic significance.Oncotarget. 2016 Dec 13;7(50):82783-82797. doi: 10.18632/oncotarget.12635.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.