General Information of Drug Off-Target (DOT) (ID: OTTG7P8R)

DOT Name AN1-type zinc finger protein 2A
Gene Name ZFAND2A
UniProt ID
ZFN2A_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF01428
Sequence
MEFPDLGKHCSEKTCKQLDFLPVKCDACKQDFCKDHFPYAAHKCPFAFQKDVHVPVCPLC
NTPIPVKKGQIPDVVVGDHIDRDCDSHPGKKKEKIFTYRCSKEGCKKKEMLQMVCAQCHG
NFCIQHRHPLDHSCRHGSRPTIKAG

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of AN1-type zinc finger protein 2A. [1]
------------------------------------------------------------------------------------
26 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of AN1-type zinc finger protein 2A. [2]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of AN1-type zinc finger protein 2A. [3]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of AN1-type zinc finger protein 2A. [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of AN1-type zinc finger protein 2A. [5]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of AN1-type zinc finger protein 2A. [6]
Estradiol DMUNTE3 Approved Estradiol increases the expression of AN1-type zinc finger protein 2A. [7]
Temozolomide DMKECZD Approved Temozolomide increases the expression of AN1-type zinc finger protein 2A. [8]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of AN1-type zinc finger protein 2A. [9]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of AN1-type zinc finger protein 2A. [10]
Menadione DMSJDTY Approved Menadione affects the expression of AN1-type zinc finger protein 2A. [11]
Bortezomib DMNO38U Approved Bortezomib increases the expression of AN1-type zinc finger protein 2A. [12]
Azathioprine DMMZSXQ Approved Azathioprine increases the expression of AN1-type zinc finger protein 2A. [13]
Carfilzomib DM48K0X Approved Carfilzomib increases the expression of AN1-type zinc finger protein 2A. [14]
HMPL-004 DM29XGY Phase 3 HMPL-004 decreases the expression of AN1-type zinc finger protein 2A. [15]
Bardoxolone methyl DMODA2X Phase 3 Bardoxolone methyl decreases the expression of AN1-type zinc finger protein 2A. [15]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of AN1-type zinc finger protein 2A. [16]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of AN1-type zinc finger protein 2A. [17]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN increases the expression of AN1-type zinc finger protein 2A. [18]
MG-132 DMKA2YS Preclinical MG-132 increases the expression of AN1-type zinc finger protein 2A. [19]
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the expression of AN1-type zinc finger protein 2A. [20]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of AN1-type zinc finger protein 2A. [21]
Sulforaphane DMQY3L0 Investigative Sulforaphane decreases the expression of AN1-type zinc finger protein 2A. [15]
chloropicrin DMSGBQA Investigative chloropicrin increases the expression of AN1-type zinc finger protein 2A. [22]
Deguelin DMXT7WG Investigative Deguelin increases the expression of AN1-type zinc finger protein 2A. [23]
crotylaldehyde DMTWRQI Investigative crotylaldehyde increases the expression of AN1-type zinc finger protein 2A. [24]
Bilirubin DMI0V4O Investigative Bilirubin increases the expression of AN1-type zinc finger protein 2A. [25]
------------------------------------------------------------------------------------
⏷ Show the Full List of 26 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Inter-laboratory comparison of human renal proximal tubule (HK-2) transcriptome alterations due to Cyclosporine A exposure and medium exhaustion. Toxicol In Vitro. 2009 Apr;23(3):486-99.
3 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
7 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
8 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
9 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
10 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
11 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
12 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
13 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
14 The Zinc-Finger AN1-Type Domain 2a Gene Acts as a Regulator of Cell Survival in Human Melanoma: Role of E3-Ligase cIAP2. Mol Cancer Res. 2019 Dec;17(12):2444-2456. doi: 10.1158/1541-7786.MCR-19-0243. Epub 2019 Sep 20.
15 Mapping the dynamics of Nrf2 antioxidant and NFB inflammatory responses by soft electrophilic chemicals in human liver cells defines the transition from adaptive to adverse responses. Toxicol In Vitro. 2022 Oct;84:105419. doi: 10.1016/j.tiv.2022.105419. Epub 2022 Jun 17.
16 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
17 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
18 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
19 The proteasome inhibitor bortezomib is a potent inducer of zinc finger AN1-type domain 2a gene expression: role of heat shock factor 1 (HSF1)-heat shock factor 2 (HSF2) heterocomplexes. J Biol Chem. 2014 May 2;289(18):12705-15. doi: 10.1074/jbc.M113.513242. Epub 2014 Mar 11.
20 Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
21 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
22 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
23 Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
24 Gene expression profile and cytotoxicity of human bronchial epithelial cells exposed to crotonaldehyde. Toxicol Lett. 2010 Aug 16;197(2):113-22.
25 Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.