Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTU15GMK)

• DOT Name: Nuclear receptor-interacting protein 3 (NRIP3)
• Synonyms: Sarcoma antigen NY-SAR-105
• Gene Name: NRIP3
• UniProt ID: NRIP3_HUMAN
• Pfam ID: PF09668
• Sequence:
  MFYSGLLTEGGRKETDMREAASLRQQRRMKQAVQFIHKDSADLLPLDGLKKLGSSKDMQP
  HNILQRRLMETNLSKLRSGPRVPWASKTNKLNQAKSEGLKKSEEDDMILVSCQCAGKDVK
  ALVDTGCLYNLISLACVDRLGLKEHVKSHKHEGEKLSLPRHLKVVGQIEHLVITLGSLRL
  DCPAAVVDDNEKNLSLGLQTLRSLKCIINLDKHRLIMGKTDKEEIPFVETVSLNEDNTSE
  A

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Topotecan	DMP6G8T	Approved	Nuclear receptor-interacting protein 3 (NRIP3) affects the response to substance of Topotecan.	[20]

19 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Nuclear receptor-interacting protein 3 (NRIP3).	[1]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Nuclear receptor-interacting protein 3 (NRIP3).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Nuclear receptor-interacting protein 3 (NRIP3).	[3]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of Nuclear receptor-interacting protein 3 (NRIP3).	[4]
Arsenic	DMTL2Y1	Approved	Arsenic affects the expression of Nuclear receptor-interacting protein 3 (NRIP3).	[5]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Nuclear receptor-interacting protein 3 (NRIP3).	[6]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Nuclear receptor-interacting protein 3 (NRIP3).	[7]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Nuclear receptor-interacting protein 3 (NRIP3).	[8]
Panobinostat	DM58WKG	Approved	Panobinostat decreases the expression of Nuclear receptor-interacting protein 3 (NRIP3).	[9]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Nuclear receptor-interacting protein 3 (NRIP3).	[10]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Nuclear receptor-interacting protein 3 (NRIP3).	[11]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Nuclear receptor-interacting protein 3 (NRIP3).	[12]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Nuclear receptor-interacting protein 3 (NRIP3).	[9]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Nuclear receptor-interacting protein 3 (NRIP3).	[13]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Nuclear receptor-interacting protein 3 (NRIP3).	[15]
PMID27336223-Compound-5	DM6E50A	Patented	PMID27336223-Compound-5 increases the expression of Nuclear receptor-interacting protein 3 (NRIP3).	[16]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Nuclear receptor-interacting protein 3 (NRIP3).	[17]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Nuclear receptor-interacting protein 3 (NRIP3).	[18]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Nuclear receptor-interacting protein 3 (NRIP3).	[19]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Nuclear receptor-interacting protein 3 (NRIP3).	[14]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [3] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [4] Identification of novel low-dose bisphenol a targets in human foreskin fibroblast cells derived from hypospadias patients. PLoS One. 2012;7(5):e36711. doi: 10.1371/journal.pone.0036711. Epub 2012 May 4.
• [5] Drinking-water arsenic exposure modulates gene expression in human lymphocytes from a U.S. population. Environ Health Perspect. 2008 Apr;116(4):524-31. doi: 10.1289/ehp.10861.
• [6] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [7] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [8] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [9] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [10] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [11] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [12] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [13] Quantitative proteomics and transcriptomics addressing the estrogen receptor subtype-mediated effects in T47D breast cancer cells exposed to the phytoestrogen genistein. Mol Cell Proteomics. 2011 Jan;10(1):M110.002170.
• [14] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [15] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [16] PPARgamma controls CD1d expression by turning on retinoic acid synthesis in developing human dendritic cells. J Exp Med. 2006 Oct 2;203(10):2351-62.
• [17] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [18] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [19] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [20] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.