Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTU5Z3YK)

• DOT Name: Complement C1q tumor necrosis factor-related protein 8 (C1QTNF8)
• Synonyms: C1q/TNF-related protein 8; CTRP8
• Gene Name: C1QTNF8
• Related Disease:
  Adult glioblastoma
  Brain neoplasm
  Glioblastoma multiforme
  Type-1 diabetes
• UniProt ID: C1QT8_HUMAN
• Pfam ID: PF00386 ; PF01391
• Sequence:
  MAAPALLLLALLLPVGAWPGLPRRPCVHCCRPAWPPGPYARVSDRDLWRGDLWRGLPRVR
  PTIDIEILKGEKGEAGVRGRAGRSGKEGPPGARGLQGRRGQKGQVGPPGAACRRAYAAFS
  VGRREGLHSSDHFQAVPFDTELVNLDGAFDLAAGRFLCTVPGVYFLSLNVHTWNYKETYL
  HIMLNRRPAAVLYAQPSERSVMQAQSLMLLLAAGDAVWVRMFQRDRDNAIYGEHGDLYIT
  FSGHLVKPAAEL
• Function: May play a role as ligand of RXFP1.
• Tissue Specificity: Expressed predominantly in lung and testis . Expressed in astrocytes .

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult glioblastoma	DISVP4LU	Limited	Biomarker	[1]
Brain neoplasm	DISY3EKS	Limited	Biomarker	[1]
Glioblastoma multiforme	DISK8246	Limited	Biomarker	[1]
Type-1 diabetes	DIS7HLUB	Limited	Biomarker	[2]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Complement C1q tumor necrosis factor-related protein 8 (C1QTNF8).	[3]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Complement C1q tumor necrosis factor-related protein 8 (C1QTNF8).	[6]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Complement C1q tumor necrosis factor-related protein 8 (C1QTNF8).	[4]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of Complement C1q tumor necrosis factor-related protein 8 (C1QTNF8).	[5]

References

• [1] C1q/TNF-related peptide 8 (CTRP8) promotes temozolomide resistance in human glioblastoma.Mol Oncol. 2018 Sep;12(9):1464-1479. doi: 10.1002/1878-0261.12349. Epub 2018 Aug 2.
• [2] Analysis of loss-of-function variants and 20 risk factor phenotypes in 8,554 individuals identifies loci influencing chronic disease.Nat Genet. 2015 Jun;47(6):640-2. doi: 10.1038/ng.3270. Epub 2015 Apr 27.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [5] Inorganic arsenic exposure promotes malignant progression by HDAC6-mediated down-regulation of HTRA1. J Appl Toxicol. 2023 Aug;43(8):1214-1224. doi: 10.1002/jat.4457. Epub 2023 Mar 11.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.