Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTU7XLZL)

• DOT Name: Spermatid perinuclear RNA-binding protein (STRBP)
• Gene Name: STRBP
• Related Disease:
  Lung adenocarcinoma
  Cryptorchidism
• UniProt ID: STRBP_HUMAN
• PDB ID: 2DMY
• Pfam ID: PF00035 ; PF20965 ; PF07528
• Sequence:
  MRSIRSFANDDRHVMVKHSTIYPSPEELEAVQNMVSTVECALKHVSDWLDETNKGTKTEG
  ETEVKKDEAGENYSKDQGGRTLCGVMRIGLVAKGLLIKDDMDLELVLMCKDKPTETLLNT
  VKDNLPIQIQKLTEEKYQVEQCVNEASIIIRNTKEPTLTLKVILTSPLIRDELEKKDGEN
  VSMKDPPDLLDRQKCLNALASLRHAKWFQARANGLKSCVIVLRILRDLCNRVPTWAPLKG
  WPLELICEKSIGTCNRPLGAGEALRRVMECLASGILLPGGPGLHDPCERDPTDALSYMTI
  QQKEDITHSAQHALRLSAFGQIYKVLEMDPLPSSKPFQKYSWSVTDKEGAGSSALKRPFE
  DGLGDDKDPNKKMKRNLRKILDSKAIDLMNALMRLNQIRPGLQYKLLSQSGPVHAPVFTM
  SVDVDGTTYEASGPSKKTAKLHVAVKVLQAMGYPTGFDADIECMSSDEKSDNESKNETVS
  SNSSNNTGNSTTETSSTLEVRTQGPILTASGKNPVMELNEKRRGLKYELISETGGSHDKR
  FVMEVEVDGQKFRGAGPNKKVAKASAALAALEKLFSGPNAANNKKKKIIPQAKGVVNTAV
  SAAVQAVRGRGRGTLTRGAFVGATAAPGYIAPGYGTPYGYSTAAPAYGLPKRMVLLPVMK
  FPTYPVPHYSFF
• Function: Involved in spermatogenesis and sperm function. Plays a role in regulation of cell growth. Binds to double-stranded DNA and RNA. Binds most efficiently to poly(I:C) RNA than to poly(dI:dC) DNA. Binds also to single-stranded poly(G) RNA. Binds non-specifically to the mRNA PRM1 3'-UTR and adenovirus VA RNA.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[1]
Cryptorchidism	DISYUD2P	Limited	Altered Expression	[2]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Spermatid perinuclear RNA-binding protein (STRBP).	[3]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Spermatid perinuclear RNA-binding protein (STRBP).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Spermatid perinuclear RNA-binding protein (STRBP).	[5]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Spermatid perinuclear RNA-binding protein (STRBP).	[6]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Spermatid perinuclear RNA-binding protein (STRBP).	[7]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Spermatid perinuclear RNA-binding protein (STRBP).	[8]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Spermatid perinuclear RNA-binding protein (STRBP).	[9]
Cidofovir	DMA13GD	Approved	Cidofovir decreases the expression of Spermatid perinuclear RNA-binding protein (STRBP).	[4]
Fenofibrate	DMFKXDY	Approved	Fenofibrate increases the expression of Spermatid perinuclear RNA-binding protein (STRBP).	[4]
Ibuprofen	DM8VCBE	Approved	Ibuprofen increases the expression of Spermatid perinuclear RNA-binding protein (STRBP).	[4]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the expression of Spermatid perinuclear RNA-binding protein (STRBP).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Spermatid perinuclear RNA-binding protein (STRBP).	[10]

References

• [1] c-Myc targeted regulators of cell metabolism in a transgenic mouse model of papillary lung adenocarcinoma.Oncotarget. 2016 Oct 4;7(40):65514-65539. doi: 10.18632/oncotarget.11804.
• [2] Expression of STRBP mRNA in patients with cryptorchidism and Down's syndrome.J Endocrinol Invest. 2012 Jan;35(1):5-7. doi: 10.1007/BF03345414.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [5] Gene expression changes associated with cytotoxicity identified using cDNA arrays. Funct Integr Genomics. 2000 Sep;1(2):114-26.
• [6] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [7] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [8] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [9] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [10] Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.