| DOT Name |
Signal peptidase complex subunit 1 (SPCS1)
|
| Synonyms |
Microsomal signal peptidase 12 kDa subunit; SPase 12 kDa subunit |
| Gene Name |
SPCS1
|
| Related Disease |
- Alzheimer disease ( )
- Knee osteoarthritis ( )
- Major depressive disorder ( )
- Osteoarthritis ( )
- Bipolar disorder ( )
|
| UniProt ID |
|
| 3D Structure |
|
| PDB ID |
|
| Pfam ID |
|
| Sequence |
MARGGDTGCTGPSETSASGAAAIALPGLEGPATDAQCQTLPLTVLKSRSPSPRSLPPALS
CPPPQPAMLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVM
AGFAFSCLLTLPPWPIYRRHPLKWLPVQESSTDDKKPGERKIKRHAKNN
|
| Function |
Component of the signal peptidase complex (SPC) which catalyzes the cleavage of N-terminal signal sequences from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum. Dispensable for SPC enzymatic activity; (Microbial infection) Required for the post-translational processing of proteins involved in virion assembly and secretion from flaviviruses such as West Nile virus (WNV), Japanese encephalitis virus (JEV), Dengue virus type 2 (DENV-2), Yellow Fever virus (YFV), Zika virus (ZIKV) and hepatitis C virus (HCV). Plays a key role in the post-translational processing of flaviviral structural proteins prM, E, and NS1. In HCV, it is involved in virion assembly where it promotes the interaction between HCV virus proteins NS2 and E2.
|
| KEGG Pathway |
- Protein export (hsa03060 )
|
| Reactome Pathway |
- Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1) (R-HSA-381771 )
- Synthesis, secretion, and inactivation of Glucose-dependent Insulinotropic Polypeptide (GIP) (R-HSA-400511 )
- Synthesis, secretion, and deacylation of Ghrelin (R-HSA-422085 )
- SRP-dependent cotranslational protein targeting to membrane (R-HSA-1799339 )
|
|
|
|
|
|
|
