Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUNPYCE)

• DOT Name: Secretory carrier-associated membrane protein 3 (SCAMP3)
• Synonyms: Secretory carrier membrane protein 3
• Gene Name: SCAMP3
• Related Disease:
  Hepatocellular carcinoma
  Melanoma
  Neoplasm
  Crohn disease
  Inflammatory bowel disease
• UniProt ID: SCAM3_HUMAN
• Pfam ID: PF04144
• Sequence:
  MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAP
  LPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAATAELLKKQEELNRKAEELDRREREL
  QHAALGGTATRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTVSTMYYLWMCSTLALLL
  NFLACLASFCVETNNGAGFGLSILWVLLFTPCSFVCWYRPMYKAFRSDSSFNFFVFFFIF
  FVQDVLFVLQAIGIPGWGFSGWISALVVPKGNTAVSVLMLLVALLFTGIAVLGIVMLKRI
  HSLYRRTGASFQKAQQEFAAGVFSNPAVRTAAANAAAGAAENAFRAP
• Function: Functions in post-Golgi recycling pathways. Acts as a recycling carrier to the cell surface.
• Tissue Specificity: Widely expressed, with highest expression in heart and skeletal muscle.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[1]
Melanoma	DIS1RRCY	Strong	Biomarker	[2]
Neoplasm	DISZKGEW	moderate	Altered Expression	[1]
Crohn disease	DIS2C5Q8	Limited	Genetic Variation	[3]
Inflammatory bowel disease	DISGN23E	Limited	Genetic Variation	[3]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Secretory carrier-associated membrane protein 3 (SCAMP3).	[4]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Secretory carrier-associated membrane protein 3 (SCAMP3).	[5]
Selenium	DM25CGV	Approved	Selenium increases the expression of Secretory carrier-associated membrane protein 3 (SCAMP3).	[6]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Secretory carrier-associated membrane protein 3 (SCAMP3).	[6]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Secretory carrier-associated membrane protein 3 (SCAMP3).	[8]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Secretory carrier-associated membrane protein 3 (SCAMP3).	[10]
Aminohippuric acid	DMUN54G	Investigative	Aminohippuric acid affects the expression of Secretory carrier-associated membrane protein 3 (SCAMP3).	[11]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Secretory carrier-associated membrane protein 3 (SCAMP3).	[7]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Secretory carrier-associated membrane protein 3 (SCAMP3).	[9]

References

• [1] Overexpression of SCAMP3 is an indicator of poor prognosis in hepatocellular carcinoma.Oncotarget. 2017 Nov 27;8(65):109247-109257. doi: 10.18632/oncotarget.22665. eCollection 2017 Dec 12.
• [2] Metformin Treatment Suppresses Melanoma Cell Growth and Motility Through Modulation of microRNA Expression.Cancers (Basel). 2019 Feb 11;11(2):209. doi: 10.3390/cancers11020209.
• [3] Genome-wide association study implicates immune activation of multiple integrin genes in inflammatory bowel disease.Nat Genet. 2017 Feb;49(2):256-261. doi: 10.1038/ng.3760. Epub 2017 Jan 9.
• [4] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [5] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [6] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [9] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [10] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [11] Cancer-related proteins in serum are altered in workers occupationally exposed to polycyclic aromatic hydrocarbons: a cross-sectional study. Carcinogenesis. 2019 Jul 6;40(6):771-781. doi: 10.1093/carcin/bgz022.