Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVNQD3I)

DOT Name Dermatan-sulfate epimerase-like protein (DSEL)
Synonyms EC 5.1.-.-
Gene Name DSEL
Related Disease
Congenital diaphragmatic hernia ( )
Diabetic kidney disease ( )
Microphthalmia ( )
Non-insulin dependent diabetes ( )
UniProt ID
DSEL_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
5.1.-.-
Pfam ID
PF00685
Sequence
MALMFTGHLLFLALLMFAFSTFEESVSNYSEWAVFTDDIDQFKTQKVQDFRPNQKLKKSM
LHPSLYFDAGEIQAMRQKSRASHLHLFRAIRSAVTVMLSNPTYYLPPPKHADFAAKWNEI
YGNNLPPLALYCLLCPEDKVAFEFVLEYMDRMVGYKDWLVENAPGDEVPIGHSLTGFATA
FDFLYNLLDNHRRQKYLEKIWVITEEMYEYSKVRSWGKQLLHNHQATNMIALLTGALVTG
VDKGSKANIWKQAVVDVMEKTMFLLNHIVDGSLDEGVAYGSYTAKSVTQYVFLAQRHFNI
NNLDNNWLKMHFWFYYATLLPGFQRTVGIADSNYNWFYGPESQLVFLDKFILKNGAGNWL
AQQIRKHRPKDGPMVPSTAQRWSTLHTEYIWYDPQLTPQPPADYGTAKIHTFPNWGVVTY
GAGLPNTQTNTFVSFKSGKLGGRAVYDIVHFQPYSWIDGWRSFNPGHEHPDQNSFTFAPN
GQVFVSEALYGPKLSHLNNVLVFAPSPSSQCNKPWEGQLGECAQWLKWTGEEVGDAAGEI
ITASQHGEMVFVSGEAVSAYSSAMRLKSVYRALLLLNSQTLLVVDHIERQEDSPINSVSA
FFHNLDIDFKYIPYKFMNRYNGAMMDVWDAHYKMFWFDHHGNSPMASIQEAEQAAEFKKR
WTQFVNVTFQMEPTITRIAYVFYGPYINVSSCRFIDSSNPGLQISLNVNNTEHVVSIVTD
YHNLKTRFNYLGFGGFASVADQGQITRFGLGTQAIVKPVRHDRIIFPFGFKFNIAVGLIL
CISLVILTFQWRFYLSFRKLMRWILILVIALWFIELLDVWSTCSQPICAKWTRTEAEGSK
KSLSSEGHHMDLPDVVITSLPGSGAEILKQLFFNSSDFLYIRVPTAYIDIPETELEIDSF
VDACEWKVSDIRSGHFRLLRGWLQSLVQDTKLHLQNIHLHEPNRGKLAQYFAMNKDKKRK
FKRRESLPEQRSQMKGAFDRDAEYIRALRRHLVYYPSARPVLSLSSGSWTLKLHFFQEVL
GASMRALYIVRDPRAWIYSMLYNSKPSLYSLKNVPEHLAKLFKIEGGKGKCNLNSGYAFE
YEPLRKELSKSKSNAVSLLSHLWLANTAAALRINTDLLPTSYQLVKFEDIVHFPQKTTER
IFAFLGIPLSPASLNQILFATSTNLFYLPYEGEISPTNTNVWKQNLPRDEIKLIENICWT
LMDRLGYPKFMD
Tissue Specificity Expressed in different brain areas as well as in multiple other peripheral tissues.
KEGG Pathway
Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate (hsa00532 )
Metabolic pathways (hsa01100 )
Reactome Pathway
Dermatan sulfate biosynthesis (R-HSA-2022923 )

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Congenital diaphragmatic hernia DIS0IPVU Strong Biomarker [1]
Diabetic kidney disease DISJMWEY Strong Genetic Variation [2]
Microphthalmia DISGEBES Strong Biomarker [1]
Non-insulin dependent diabetes DISK1O5Z Strong Genetic Variation [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
13 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Dermatan-sulfate epimerase-like protein (DSEL). [3]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Dermatan-sulfate epimerase-like protein (DSEL). [4]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Dermatan-sulfate epimerase-like protein (DSEL). [5]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of Dermatan-sulfate epimerase-like protein (DSEL). [6]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Dermatan-sulfate epimerase-like protein (DSEL). [6]
Zoledronate DMIXC7G Approved Zoledronate decreases the expression of Dermatan-sulfate epimerase-like protein (DSEL). [7]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Dermatan-sulfate epimerase-like protein (DSEL). [8]
OTX-015 DMI8RG1 Phase 1/2 OTX-015 increases the expression of Dermatan-sulfate epimerase-like protein (DSEL). [9]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 increases the expression of Dermatan-sulfate epimerase-like protein (DSEL). [9]
Mivebresib DMCPF90 Phase 1 Mivebresib increases the expression of Dermatan-sulfate epimerase-like protein (DSEL). [9]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Dermatan-sulfate epimerase-like protein (DSEL). [11]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Dermatan-sulfate epimerase-like protein (DSEL). [12]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Dermatan-sulfate epimerase-like protein (DSEL). [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 13 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Dermatan-sulfate epimerase-like protein (DSEL). [10]
------------------------------------------------------------------------------------

References

1 A maternally inherited chromosome 18q22.1 deletion in a male with late-presenting diaphragmatic hernia and microphthalmia-evaluation of DSEL as a candidate gene for the diaphragmatic defect.Am J Med Genet A. 2010 Apr;152A(4):916-23. doi: 10.1002/ajmg.a.33341.
2 Association of POL1, MALT1, MC4R, PHLPP and DSEL single nucleotide polymorphisms in chromosome 18q region with type 2 diabetes in Tunisians.Gene. 2013 Sep 15;527(1):243-7. doi: 10.1016/j.gene.2013.05.015. Epub 2013 May 29.
3 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
4 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
5 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
6 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
7 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
8 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
9 Comprehensive transcriptome profiling of BET inhibitor-treated HepG2 cells. PLoS One. 2022 Apr 29;17(4):e0266966. doi: 10.1371/journal.pone.0266966. eCollection 2022.
10 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
11 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
12 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
13 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.