Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWFM5G0)

• DOT Name: Atos homolog protein A (ATOSA)
• Gene Name: ATOSA
• UniProt ID: ATOSA_HUMAN
• Pfam ID: PF13889 ; PF13915
• Sequence:
  MKPDRDTLDEYFEYDAEEFLVSLALLITEGRTPECSVKGRTESFHCPPAQSCYPVTTKHE
  CSDKLAQCRQARRTRSEVTLLWKNNLPIMVEMMLLPDCCYSDDGPTTEGIDLNDPAIKQD
  ALLLERWILEPVPRQNGDRFIEEKTLLLAVRSFVFFSQLSAWLSVSHGAIPRNILYRISA
  ADVDLQWNFSQTPIEHVFPVPNVSHNVALKVSVQSLPRQSNYPVLTCSIHTNIGLYEKRI
  QQHKLKTHQHHNPNEAEQCGTNSSQRLCSKQTWTMAPESVLHAKSGPSPEYTAAVKNIKL
  YPGTGSKSDHGTSQANILGFSGIGDIKSQETSVRTLKSFSMVDSSISNRQSFWQSAGETN
  PLIGSLIQERQEIIARIAQHLIHCDPSTSHVSGRPFNTQESSSLHSKLFRVSQENENVGK
  GKEAFSMTFGSPEFSSPEDTNEGKIRLKPETPRSETCISNDFYSHMPVGETNPLIGSLLQ
  ERQDVIARIAQHLEHIDPTASHIPRQSFNMHDSSSVASKVFRSSYEDKNLLKKNKDESSV
  SISHTKCSLLGDISDGKNLVPNKCFTSFKNNSKEKCSLKHQTRNQCQNNPSEIIQSTYQE
  TQNKSSSLSTSSILSQHKENNLDLTSRFKEQEMSNGIDKQYSNCTTIDKQICTNKYKEKI
  INENYNPKFFGNLQSDDSKKNDSKIKVTVLEMSEYLNKYESMSSNKDSKRPKTCEQNTQL
  NSIENYLNKDNEGFKCKKSDQLKNEQDKQEDPTNEKSQNYSQRRSIKDCLSTCEQPKNTE
  VLRTTLKHSNVWRKHNFHSLDGTSTRAFHPQTGLPLLSSPVPQRKTQSGCFDLDSSLLHL
  KSFSSRSPRPCLNIEDDPDIHEKPFLSSSAPPITSLSLLGNFEESVLNYRFDPLGIVDGF
  TAEVGASGAFCPTHLTLPVEVSFYSVSDDNAPSPYMGVITLESLGKRGYRVPPSGTIQVT
  LFNPNKTVVKMFVVIYDLRDMPANHQTFLRQRTFSVPVKQEVKRSVNKENIRHTEERLLR
  YLIHLRFQSSKSGKIYLHRDVRLLFSRKSMEVDSGAAYELKSYTESPTNPQFSPRC
• Function: Transcription regulator that syncronizes transcriptional and translational programs to promote macrophage invasion of tissues.

Molecular Interaction Atlas (MIA) of This DOT

20 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Atos homolog protein A (ATOSA).	[1]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Atos homolog protein A (ATOSA).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Atos homolog protein A (ATOSA).	[3]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Atos homolog protein A (ATOSA).	[4]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Atos homolog protein A (ATOSA).	[3]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the expression of Atos homolog protein A (ATOSA).	[3]
Cidofovir	DMA13GD	Approved	Cidofovir decreases the expression of Atos homolog protein A (ATOSA).	[3]
Ifosfamide	DMCT3I8	Approved	Ifosfamide decreases the expression of Atos homolog protein A (ATOSA).	[3]
Clodronate	DM9Y6X7	Approved	Clodronate decreases the expression of Atos homolog protein A (ATOSA).	[3]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Atos homolog protein A (ATOSA).	[5]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Atos homolog protein A (ATOSA).	[6]
GSK2110183	DMZHB37	Phase 2	GSK2110183 increases the expression of Atos homolog protein A (ATOSA).	[7]
GDC0941	DM1YAK6	Phase 2	GDC0941 increases the expression of Atos homolog protein A (ATOSA).	[8]
GDC-0980/RG7422	DMF3MV1	Phase 2	GDC-0980/RG7422 increases the expression of Atos homolog protein A (ATOSA).	[8]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Atos homolog protein A (ATOSA).	[1]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Atos homolog protein A (ATOSA).	[9]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Atos homolog protein A (ATOSA).	[10]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Atos homolog protein A (ATOSA).	[11]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Atos homolog protein A (ATOSA).	[12]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate increases the expression of Atos homolog protein A (ATOSA).	[13]

References

• [1] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [2] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [3] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [4] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [5] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [6] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [7] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [8] Phosphoinositide 3-kinase (PI3K) pathway alterations are associated with histologic subtypes and are predictive of sensitivity to PI3K inhibitors in lung cancer preclinical models. Clin Cancer Res. 2012 Dec 15;18(24):6771-83. doi: 10.1158/1078-0432.CCR-12-2347. Epub 2012 Nov 7.
• [9] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [10] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [11] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [12] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [13] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.