Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTX1K4IH)

DOT Name HIG1 domain family member 2A, mitochondrial (HIGD2A)
Synonyms RCF1 homolog B; RCF1b
Gene Name HIGD2A
Related Disease
Liver cancer ( )
Precancerous condition ( )
UniProt ID
HIG2A_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF04588
Sequence
MATPGPVIPEVPFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTRENPVVPIGCLATAAAL
TYGLYSFHRGNSQRSQLMMRTRIAAQGFTVAAILLGLAVTAMKSRP
Function
Proposed subunit of cytochrome c oxidase (COX, complex IV), which is the terminal component of the mitochondrial respiratory chain that catalyzes the reduction of oxygen to water. May be involved in cytochrome c oxidase activity. May play a role in the assembly of respiratory supercomplexes.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Liver cancer DISDE4BI Strong Biomarker [1]
Precancerous condition DISV06FL Strong Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of HIG1 domain family member 2A, mitochondrial (HIGD2A). [2]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of HIG1 domain family member 2A, mitochondrial (HIGD2A). [3]
Tocopherol DMBIJZ6 Phase 2 Tocopherol increases the expression of HIG1 domain family member 2A, mitochondrial (HIGD2A). [4]
Milchsaure DM462BT Investigative Milchsaure affects the expression of HIG1 domain family member 2A, mitochondrial (HIGD2A). [5]
chloropicrin DMSGBQA Investigative chloropicrin increases the expression of HIG1 domain family member 2A, mitochondrial (HIGD2A). [6]
------------------------------------------------------------------------------------

References

1 Multiple genes exhibit phenobarbital-induced constitutive active/androstane receptor-mediated DNA methylation changes during liver tumorigenesis and in liver tumors.Toxicol Sci. 2009 Apr;108(2):273-89. doi: 10.1093/toxsci/kfp031. Epub 2009 Feb 20.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
4 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
5 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
6 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.