Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTX3LUGI)

• DOT Name: RNA-binding protein 34 (RBM34)
• Synonyms: RNA-binding motif protein 34
• Gene Name: RBM34
• UniProt ID: RBM34_HUMAN
• Pfam ID: PF00076
• Sequence:
  MALEGMSKRKRKRSVQEGENPDDGVRGSPPEDYRLGQVASSLFRGEHHSRGGTGRLASLF
  SSLEPQIQPVYVPVPKQTIKKTKRNEEEESTSQIERPLSQEPAKKVKAKKKHTNAEKKLA
  DRESALASADLEEEIHQKQGQKRKNSQPGVKVADRKILDDTEDTVVSQRKKIQINQEEER
  LKNERTVFVGNLPVTCNKKKLKSFFKEYGQIESVRFRSLIPAEGTLSKKLAAIKRKIHPD
  QKNINAYVVFKEESAATQALKRNGAQIADGFRIRVDLASETSSRDKRSVFVGNLPYKVEE
  SAIEKHFLDCGSIMAVRIVRDKMTGIGKGFGYVLFENTDSVHLALKLNNSELMGRKLRVM
  RSVNKEKFKQQNSNPRLKNVSKPKQGLNFTSKTAEGHPKSLFIGEKAVLLKTKKKGQKKS
  GRPKKQRKQK

Molecular Interaction Atlas (MIA) of This DOT

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of RNA-binding protein 34 (RBM34).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of RNA-binding protein 34 (RBM34).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of RNA-binding protein 34 (RBM34).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of RNA-binding protein 34 (RBM34).	[4]
Decitabine	DMQL8XJ	Approved	Decitabine decreases the expression of RNA-binding protein 34 (RBM34).	[5]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of RNA-binding protein 34 (RBM34).	[5]
Etoposide	DMNH3PG	Approved	Etoposide decreases the expression of RNA-binding protein 34 (RBM34).	[4]
Mitomycin	DMH0ZJE	Approved	Mitomycin decreases the expression of RNA-binding protein 34 (RBM34).	[4]
Colchicine	DM2POTE	Approved	Colchicine decreases the expression of RNA-binding protein 34 (RBM34).	[4]
Adenine	DMZLHKJ	Approved	Adenine decreases the expression of RNA-binding protein 34 (RBM34).	[4]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of RNA-binding protein 34 (RBM34).	[8]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of RNA-binding protein 34 (RBM34).	[9]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of RNA-binding protein 34 (RBM34).	[6]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of RNA-binding protein 34 (RBM34).	[7]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid decreases the phosphorylation of RNA-binding protein 34 (RBM34).	[10]

References

• [1] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [4] Utilization of CDKN1A/p21 gene for class discrimination of DNA damage-induced clastogenicity. Toxicology. 2014 Jan 6;315:8-16. doi: 10.1016/j.tox.2013.10.009. Epub 2013 Nov 6.
• [5] The DNA methyltransferase inhibitors azacitidine, decitabine and zebularine exert differential effects on cancer gene expression in acute myeloid leukemia cells. Leukemia. 2009 Jun;23(6):1019-28.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [8] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [9] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [10] Functional lipidomics: Palmitic acid impairs hepatocellular carcinoma development by modulating membrane fluidity and glucose metabolism. Hepatology. 2017 Aug;66(2):432-448. doi: 10.1002/hep.29033. Epub 2017 Jun 16.