Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTYY24AN)

• DOT Name: Uncharacterized protein KIAA1143 (KIAA1143)
• Gene Name: KIAA1143
• UniProt ID: K1143_HUMAN
• Pfam ID: PF15377
• Sequence:
  MSKRNQVSYVRPAEPAFLARFKERVGYREGPTVETKRIQPQPPDEDGDHSDKEDEQPQVV
  VLKKGDLSVEEVMKIKAEIKAAKADEEPTPADGRIIYRKPVKHPSDEKYSGLTASSKKKK
  PNEDEVNQDSVKKNSQKQIKNSSLLSFDNEDENE

Molecular Interaction Atlas (MIA) of This DOT

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Uncharacterized protein KIAA1143 (KIAA1143).	[1]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of Uncharacterized protein KIAA1143 (KIAA1143).	[4]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Uncharacterized protein KIAA1143 (KIAA1143).	[5]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Uncharacterized protein KIAA1143 (KIAA1143).	[4]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Uncharacterized protein KIAA1143 (KIAA1143).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Uncharacterized protein KIAA1143 (KIAA1143).	[3]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Uncharacterized protein KIAA1143 (KIAA1143).	[6]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [4] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [5] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [6] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.