Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZ2RB6L)

• DOT Name: Protein BEX5 (BEX5)
• Synonyms: Brain-expressed X-linked protein 5; NGFRAP1-like protein 1; Nerve growth factor receptor-associated protein 2
• Gene Name: BEX5
• Related Disease: Lung adenocarcinoma
• UniProt ID: BEX5_HUMAN
• Pfam ID: PF04538
• Sequence:
  MENVPKENKVVEKAPVQNEAPALGGGEYQEPGGNVKGVWAPPAPGFGEDVPNRLVDNIDM
  IDGDGDDMERFMEEMRELRRKIRELQLRYSLRILIGDPPHHDHHDEFCLMP

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[1]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Protein BEX5 (BEX5).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Protein BEX5 (BEX5).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Protein BEX5 (BEX5).	[4]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Protein BEX5 (BEX5).	[5]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Protein BEX5 (BEX5).	[6]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Protein BEX5 (BEX5).	[7]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Protein BEX5 (BEX5).	[6]
Belinostat	DM6OC53	Phase 2	Belinostat increases the expression of Protein BEX5 (BEX5).	[6]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Protein BEX5 (BEX5).	[8]

References

• [1] Diagnostic and prognostic value of the BEX family in lung adenocarcinoma.Oncol Lett. 2019 Nov;18(5):5523-5533. doi: 10.3892/ol.2019.10905. Epub 2019 Sep 20.
• [2] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [3] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [4] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [5] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [6] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [7] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.