Details of the Drug

General Information of Drug (ID: DMEYHG9)

Drug Name
Elotuzumab
Synonyms BMS-901608
Indication
Disease Entry ICD 11 Status REF
Multiple myeloma 2A83 Approved [1]
Drug Type
Antibody
Sequence
>heavy chain
EVQLVESGGGLVQPGGSLRLSCAASGFDFSRYWMSWVRQAPGKGLEWIGEINPDSSTINY
APSLKDKFIISRDNAKNSLYLQMNSLRAEDTAVYYCARPDGNYWYFDVWGQGTLVTVSSA
STKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG
LYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGP
SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS
TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ
QGNVFSCSVMHEALHNHYTQKSLSLSPGK
>light chain
DIQMTQSPSSLSASVGDRVTITCKASQDVGIAVAWYQQKPGKVPKLLIYWASTRHTGVPD
RFSGSGSGTDFTLTISSLQPEDVATYYCQQYSSYPYTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Cross-matching ID
DrugBank ID
DB06317
TTD ID
D05DZR

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
SLAM family member 7 SLAMF7 (CS1) TT7ILZ1 SLAF7_HUMAN Not Available [2]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

ICD Disease Classification 02 Neoplasm
Disease Class ICD-11: 2C82 Prostate cancer
The Studied Tissue Bone marrow
The Studied Disease Multiple myeloma [ICD-11:2C82]
Molecule Name Molecule Type Gene Name p-value Fold-Change Z-score
SLAM family member 7 SLAMF7 (CS1) DTT SLAMF7 9.74E-01 0.13 0.31
Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Elotuzumab (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Remdesivir DMBFZ6L Moderate Increased risk of hepatotoxicity by the combination of Elotuzumab and Remdesivir. 1D6YCoronavirus Disease 2019 [1D6YCoronavirus Disease 2019] [3]
Bedaquiline DM3906J Moderate Increased risk of hepatotoxicity by the combination of Elotuzumab and Bedaquiline. Antimicrobial drug resistance [MG50-MG52] [4]
Pexidartinib DMS2J0Z Major Increased risk of hepatotoxicity by the combination of Elotuzumab and Pexidartinib. Bone/articular cartilage neoplasm [2F7B] [5]
Brentuximab vedotin DMWLC57 Moderate Increased risk of peripheral neuropathy by the combination of Elotuzumab and Brentuximab vedotin. Hodgkin lymphoma [2B30] [6]
Teriflunomide DMQ2FKJ Major Increased risk of hepatotoxicity by the combination of Elotuzumab and Teriflunomide. Hyper-lipoproteinaemia [5C80] [7]
BMS-201038 DMQTAGO Major Increased risk of hepatotoxicity by the combination of Elotuzumab and BMS-201038. Hyper-lipoproteinaemia [5C80] [8]
Denosumab DMNI0KO Moderate Additive immunosuppressive effects by the combination of Elotuzumab and Denosumab. Low bone mass disorder [FB83] [9]
Idelalisib DM602WT Moderate Increased risk of hepatotoxicity by the combination of Elotuzumab and Idelalisib. Mature B-cell leukaemia [2A82] [10]
Tecfidera DM2OVDT Moderate Additive immunosuppressive effects by the combination of Elotuzumab and Tecfidera. Multiple sclerosis [8A40] [11]
Siponimod DM2R86O Major Additive immunosuppressive effects by the combination of Elotuzumab and Siponimod. Multiple sclerosis [8A40] [3]
Fingolimod DM5JVAN Major Additive immunosuppressive effects by the combination of Elotuzumab and Fingolimod. Multiple sclerosis [8A40] [12]
Ocrelizumab DMEZ2KH Moderate Additive immunosuppressive effects by the combination of Elotuzumab and Ocrelizumab. Multiple sclerosis [8A40] [13]
Ozanimod DMT6AM2 Major Additive immunosuppressive effects by the combination of Elotuzumab and Ozanimod. Multiple sclerosis [8A40] [14]
Rilonacept DMGLUQS Moderate Additive immunosuppressive effects by the combination of Elotuzumab and Rilonacept. Rheumatoid arthritis [FA20] [15]
Golimumab DMHZV7X Major Additive immunosuppressive effects by the combination of Elotuzumab and Golimumab. Rheumatoid arthritis [FA20] [16]
Anthrax vaccine DM9GSWY Moderate Antagonize the effect of Elotuzumab when combined with Anthrax vaccine. Sepsis [1G40-1G41] [17]
⏷ Show the Full List of 16 DDI Information of This Drug

References

1 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8361).
2 Market watch: Upcoming catalysts in Q2 2015. Nat Rev Drug Discov. 2015 Apr;14(4):228.
3 Cerner Multum, Inc. "Australian Product Information.".
4 Product Information. Sirturo (bedaquiline). Janssen Pharmaceuticals, Titusville, NJ.
5 Product Information. Turalio (pexidartinib). Daiichi Sankyo, Inc., Parsippany, NJ.
6 Product Information. Accolate (zafirlukast). Zeneca Pharmaceuticals, Wilmington, DE.
7 Product Information. Arava (leflunomide). Hoechst Marion-Roussel Inc, Kansas City, MO.
8 Product Information. Juxtapid (lomitapide). Aegerion Pharmaceuticals Inc, Cambridge, MA.
9 Product Information. Prolia (denosumab). Amgen USA, Thousand Oaks, CA.
10 Product Information. Zydelig (idelalisib). Gilead Sciences, Foster City, CA.
11 Product Information. Vumerity (diroximel fumarate). Alkermes, Inc, Cambridge, MA.
12 Product Information. Gilenya (fingolimod). Novartis Pharmaceuticals, East Hanover, NJ.
13 Product Information. Ocrevus (ocrelizumab). Genentech, South San Francisco, CA.
14 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
15 Product Information. Arcalyst (rilonacept). Regeneron Pharmaceuticals Inc, Tarrytown, NY.
16 Product Information. Cimzia (certolizumab). UCB Pharma Inc, Smyrna, GA.
17 CDC. Centers for Disease Control and Prevention/ "Recommendations of the advisory committtee on immunization practices (ACIP): use of vaccines and immune globulins in persons with altered immunocompetence." MMWR Morb Mortal Wkly Rep 42(RR-04) (1993): 1-18. [PMID: 20300058]