Details of the Drug

General Information of Drug (ID: DMNI0KO)

Drug Name
Denosumab
Synonyms Denosumab (USAN); Denosumab (genetical recombination); Prolia (TN); Denosumab (genetical recombination) (JAN)
Indication
Disease Entry ICD 11 Status REF
Drug-induced osteoporosis N.A. Approved [1]
Osteoporosis FB83.0 Approved [2]
Postmenopausal osteoporosis FB83.11 Approved [3]
Prostate cancer 2C82.0 Phase 3 [3]
Rheumatoid arthritis FA20 Phase 2 [3]
Drug Type
Antibody
Sequence
>heavy chain
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSGITGSGGSTYY
ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPGTTVIMSWFDPWGQGTLVTV
SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ
SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELL
GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ
YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR
DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS
RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>light chain
EIVLTQSPGTLSLSPGERATLSCRASQSVRGRYLAWYQQKPGQAPRLLIYGASSRATGIP
DRFSGSGSGTDFTLTISRLEPEDFAVFYCQQYGSSPRTFGQGTKVEIKRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
ADMET Property
Half-life
The concentration or amount of drug in body reduced by one-half in 25.4 days [4]
Cross-matching ID
DrugBank ID
DB06643
TTD ID
D08WSY
Repurposed Drugs (RPD) Click to Jump to the Detailed RPD Information of This Drug

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
Osteoclast differentiation factor (ODF) TT9E8HR TNF11_HUMAN Not Available [5]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

ICD Disease Classification 15 Disease of the musculoskeletal system/connective tissue
Disease Class ICD-11: FA20 Rheumatoid arthritis
The Studied Tissue Synovial tissue
The Studied Disease Rheumatoid arthritis [ICD-11:FA20]
Molecule Name Molecule Type Gene Name p-value Fold-Change Z-score
Osteoclast differentiation factor (ODF) DTT TNFSF11 1.51E-02 0.53 1.49
Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Denosumab (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Siltuximab DMGEATB Moderate Additive immunosuppressive effects by the combination of Denosumab and Siltuximab. Anemia [3A00-3A9Z] [6]
Dupilumab DMOAD2Y Moderate Additive immunosuppressive effects by the combination of Denosumab and Dupilumab. Atopic eczema [EA80] [6]
Eribulin DM1DX4Q Moderate Additive myelosuppressive effects by the combination of Denosumab and Eribulin. Breast cancer [2C60-2C6Y] [6]
Talazoparib DM1KS78 Moderate Additive immunosuppressive effects by the combination of Denosumab and Talazoparib. Breast cancer [2C60-2C6Y] [6]
LY2835219 DM93VBZ Moderate Additive immunosuppressive effects by the combination of Denosumab and LY2835219. Breast cancer [2C60-2C6Y] [6]
Pralatrexate DMAO80I Moderate Additive myelosuppressive effects by the combination of Denosumab and Pralatrexate. Breast cancer [2C60-2C6Y] [6]
Palbociclib DMD7L94 Moderate Additive myelosuppressive effects by the combination of Denosumab and Palbociclib. Breast cancer [2C60-2C6Y] [6]
Cabazitaxel DMPAZHC Moderate Additive myelosuppressive effects by the combination of Denosumab and Cabazitaxel. Breast cancer [2C60-2C6Y] [6]
Aflibercept DMT3D5I Moderate Additive immunosuppressive effects by the combination of Denosumab and Aflibercept. Colorectal cancer [2B91] [7]
Polatuzumab vedotin DMF6Y0L Moderate Additive myelosuppressive effects by the combination of Denosumab and Polatuzumab vedotin. Diffuse large B-cell lymphoma [2A81] [6]
Axicabtagene ciloleucel DMYHN59 Moderate Additive immunosuppressive effects by the combination of Denosumab and Axicabtagene ciloleucel. Diffuse large B-cell lymphoma [2A81] [6]
Bay 80-6946 DMLOS5R Moderate Additive myelosuppressive effects by the combination of Denosumab and Bay 80-6946. Follicular lymphoma [2A80] [6]
Avapritinib DMK2GZX Moderate Additive immunosuppressive effects by the combination of Denosumab and Avapritinib. Gastrointestinal stromal tumour [2B5B] [6]
177Lu-DOTATATE DMT8GVU Moderate Additive immunosuppressive effects by the combination of Denosumab and 177Lu-DOTATATE. Hepatitis virus infection [1E50-1E51] [6]
Brentuximab vedotin DMWLC57 Moderate Additive immunosuppressive effects by the combination of Denosumab and Brentuximab vedotin. Hodgkin lymphoma [2B30] [7]
Teriflunomide DMQ2FKJ Moderate Additive myelosuppressive effects by the combination of Denosumab and Teriflunomide. Hyper-lipoproteinaemia [5C80] [6]
Etelcalcetide DMHP9BL Major Increased risk of hypocalcemia by the combination of Denosumab and Etelcalcetide. Hyper-parathyroidism [5A51] [8]
Brigatinib DM7W94S Moderate Additive immunosuppressive effects by the combination of Denosumab and Brigatinib. Lung cancer [2C25] [6]
Lurbinectedin DMEFRTZ Moderate Additive myelosuppressive effects by the combination of Denosumab and Lurbinectedin. Lung cancer [2C25] [6]
Osimertinib DMRJLAT Moderate Additive immunosuppressive effects by the combination of Denosumab and Osimertinib. Lung cancer [2C25] [6]
Belimumab DM3OBQF Moderate Additive immunosuppressive effects by the combination of Denosumab and Belimumab. Lupus erythematosus [4A40] [6]
Ofatumumab DM295PR Moderate Additive myelosuppressive effects by the combination of Denosumab and Ofatumumab. Mature B-cell leukaemia [2A82] [6]
Obinutuzumab DM3BVAE Moderate Additive myelosuppressive effects by the combination of Denosumab and Obinutuzumab. Mature B-cell leukaemia [2A82] [6]
Idelalisib DM602WT Moderate Additive myelosuppressive effects by the combination of Denosumab and Idelalisib. Mature B-cell leukaemia [2A82] [6]
GDC-0199 DMH0QKA Moderate Additive immunosuppressive effects by the combination of Denosumab and GDC-0199. Mature B-cell leukaemia [2A82] [6]
IPI-145 DMWA24P Moderate Additive myelosuppressive effects by the combination of Denosumab and IPI-145. Mature B-cell leukaemia [2A82] [6]
Acalabrutinib DM7GCVW Moderate Additive myelosuppressive effects by the combination of Denosumab and Acalabrutinib. Mature B-cell lymphoma [2A85] [6]
Blinatumomab DMGECIJ Moderate Additive myelosuppressive effects by the combination of Denosumab and Blinatumomab. Mature B-cell lymphoma [2A85] [6]
Ibrutinib DMHZCPO Moderate Additive myelosuppressive effects by the combination of Denosumab and Ibrutinib. Mature B-cell lymphoma [2A85] [6]
Tisagenlecleucel DMM9BJD Moderate Additive immunosuppressive effects by the combination of Denosumab and Tisagenlecleucel. Mature B-cell lymphoma [2A85] [6]
Ponatinib DMYGJQO Moderate Additive myelosuppressive effects by the combination of Denosumab and Ponatinib. Mature B-cell lymphoma [2A85] [6]
Carfilzomib DM48K0X Moderate Additive myelosuppressive effects by the combination of Denosumab and Carfilzomib. Multiple myeloma [2A83] [6]
Selinexor DMBD4K3 Moderate Additive myelosuppressive effects by the combination of Denosumab and Selinexor. Multiple myeloma [2A83] [6]
Belantamab mafodotin DMBT3AI Moderate Additive immunosuppressive effects by the combination of Denosumab and Belantamab mafodotin. Multiple myeloma [2A83] [6]
Daratumumab DMKCIUZ Moderate Additive immunosuppressive effects by the combination of Denosumab and Daratumumab. Multiple myeloma [2A83] [6]
Tecfidera DM2OVDT Moderate Additive immunosuppressive effects by the combination of Denosumab and Tecfidera. Multiple sclerosis [8A40] [6]
Siponimod DM2R86O Moderate Additive immunosuppressive effects by the combination of Denosumab and Siponimod. Multiple sclerosis [8A40] [6]
Fingolimod DM5JVAN Moderate Additive immunosuppressive effects by the combination of Denosumab and Fingolimod. Multiple sclerosis [8A40] [6]
Ocrelizumab DMEZ2KH Moderate Additive immunosuppressive effects by the combination of Denosumab and Ocrelizumab. Multiple sclerosis [8A40] [6]
Deflazacort DMV0RNS Moderate Additive immunosuppressive effects by the combination of Denosumab and Deflazacort. Muscular dystrophy [8C70] [6]
Ruxolitinib DM7Q98D Moderate Additive immunosuppressive effects by the combination of Denosumab and Ruxolitinib. Myeloproliferative neoplasm [2A20] [6]
Inebilizumab DMI0RHA Moderate Additive immunosuppressive effects by the combination of Denosumab and Inebilizumab. Nervous system paraneoplastic/autoimmune disorder [8E4A] [6]
Atezolizumab DMMF8U0 Moderate Additive immunosuppressive effects by the combination of Denosumab and Atezolizumab. Non-small cell lung cancer [2C25] [6]
Olaparib DM8QB1D Moderate Additive immunosuppressive effects by the combination of Denosumab and Olaparib. Ovarian cancer [2C73] [6]
Rucaparib DM9PVX8 Moderate Additive myelosuppressive effects by the combination of Denosumab and Rucaparib. Ovarian cancer [2C73] [6]
MK-4827 DMLYGH4 Moderate Additive immunosuppressive effects by the combination of Denosumab and MK-4827. Ovarian cancer [2C73] [6]
Brodalumab DMASDQ6 Moderate Additive immunosuppressive effects by the combination of Denosumab and Brodalumab. Psoriasis [EA90] [6]
Tildrakizumab DMLW9HG Moderate Additive immunosuppressive effects by the combination of Denosumab and Tildrakizumab. Psoriasis [EA90] [6]
Risankizumab DMM32GT Moderate Additive immunosuppressive effects by the combination of Denosumab and Risankizumab. Psoriasis [EA90] [6]
Ixekizumab DMXW92T Moderate Additive immunosuppressive effects by the combination of Denosumab and Ixekizumab. Psoriasis [EA90] [6]
Upadacitinib DM32B5U Moderate Additive myelosuppressive effects by the combination of Denosumab and Upadacitinib. Rheumatoid arthritis [FA20] [6]
Baricitinib DM4ONW5 Moderate Additive myelosuppressive effects by the combination of Denosumab and Baricitinib. Rheumatoid arthritis [FA20] [6]
Tofacitinib DMBS370 Moderate Additive myelosuppressive effects by the combination of Denosumab and Tofacitinib. Rheumatoid arthritis [FA20] [6]
Golimumab DMHZV7X Moderate Additive immunosuppressive effects by the combination of Denosumab and Golimumab. Rheumatoid arthritis [FA20] [6]
Sarilumab DMOGNXY Moderate Additive myelosuppressive effects by the combination of Denosumab and Sarilumab. Rheumatoid arthritis [FA20] [6]
Mogamulizumab DMISH0Z Moderate Additive myelosuppressive effects by the combination of Denosumab and Mogamulizumab. Sezary syndrome [2B02] [6]
LEE011 DMMX75K Moderate Additive myelosuppressive effects by the combination of Denosumab and LEE011. Solid tumour/cancer [2A00-2F9Z] [6]
Pomalidomide DMTGBAX Moderate Additive myelosuppressive effects by the combination of Denosumab and Pomalidomide. Systemic sclerosis [4A42] [6]
Plicamycin DM7C8YV Moderate Additive immunosuppressive effects by the combination of Denosumab and Plicamycin. Testicular cancer [2C80] [6]
Belatacept DMXLYQF Moderate Additive immunosuppressive effects by the combination of Denosumab and Belatacept. Transplant rejection [NE84] [6]
Durvalumab DM4PVDY Moderate Additive immunosuppressive effects by the combination of Denosumab and Durvalumab. Ureteral cancer [2C92] [6]
⏷ Show the Full List of 61 DDI Information of This Drug

References

1 Hormone-Related and Drug-Induced Osteoporosis: A Cellular and Molecular Overview. Int J Mol Sci. 2023 Mar 18;24(6):5814.
2 Denosumab and incidence of type 2 diabetes among adults with osteoporosis: population based cohort study. BMJ. 2023 Apr 18;381:e073435.
3 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6886).
4 Trend Analysis of a Database of Intravenous Pharmacokinetic Parameters in Humans for 1352 Drug Compounds
5 Mullard A: 2010 FDA drug approvals. Nat Rev Drug Discov. 2011 Feb;10(2):82-5.
6 Product Information. Prolia (denosumab). Amgen USA, Thousand Oaks, CA.
7 Product Information. Lonsurf (tipiracil-trifluridine). Taiho Oncology, Inc., Princeton, NJ.
8 Cerner Multum, Inc. "Australian Product Information.".