Details of the Drug

General Information of Drug (ID: DMNI0KO)

Drug Name

Denosumab

Synonyms

Denosumab (USAN); Denosumab (genetical recombination); Prolia (TN); Denosumab (genetical recombination) (JAN)

Indication

Disease Entry	ICD 11	Status	REF
Postmenopausal osteoporosis	FB83.11	Approved	[1], [2]
Prostate cancer	2C82.0	Phase 3	[1], [2]
Rheumatoid arthritis	FA20	Phase 2	[1], [2]

Drug Type

Antibody

Sequence

>heavy chain
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSGITGSGGSTYY
ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDPGTTVIMSWFDPWGQGTLVTV
SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ
SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELL
GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ
YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR
DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS
RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
>light chain
EIVLTQSPGTLSLSPGERATLSCRASQSVRGRYLAWYQQKPGQAPRLLIYGASSRATGIP
DRFSGSGSGTDFTLTISRLEPEDFAVFYCQQYGSSPRTFGQGTKVEIKRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

ADMET Property

Half-life: The concentration or amount of drug in body reduced by one-half in 25.4 days [3]

Cross-matching ID

DrugBank ID: DB06643
TTD ID: D08WSY

Molecular Interaction Atlas of This Drug

Drug Therapeutic Target (DTT)

DTT Name	DTT ID	UniProt ID	MOA	REF
Osteoclast differentiation factor (ODF)	TT9E8HR	TNF11_HUMAN	Not Available	[2]

------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Denosumab (Comorbidity)

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Comorbidity	REF
Siltuximab	DMGEATB	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Siltuximab.	Anemia [3A00-3A9Z]	[6]
Dupilumab	DMOAD2Y	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Dupilumab.	Atopic eczema [EA80]	[6]
Eribulin	DM1DX4Q	Moderate	Additive myelosuppressive effects by the combination of Denosumab and Eribulin.	Breast cancer [2C60-2C6Y]	[6]
Talazoparib	DM1KS78	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Talazoparib.	Breast cancer [2C60-2C6Y]	[6]
LY2835219	DM93VBZ	Moderate	Additive immunosuppressive effects by the combination of Denosumab and LY2835219.	Breast cancer [2C60-2C6Y]	[6]
Pralatrexate	DMAO80I	Moderate	Additive myelosuppressive effects by the combination of Denosumab and Pralatrexate.	Breast cancer [2C60-2C6Y]	[6]
Palbociclib	DMD7L94	Moderate	Additive myelosuppressive effects by the combination of Denosumab and Palbociclib.	Breast cancer [2C60-2C6Y]	[6]
Cabazitaxel	DMPAZHC	Moderate	Additive myelosuppressive effects by the combination of Denosumab and Cabazitaxel.	Breast cancer [2C60-2C6Y]	[6]
Aflibercept	DMT3D5I	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Aflibercept.	Colorectal cancer [2B91]	[7]
Polatuzumab vedotin	DMF6Y0L	Moderate	Additive myelosuppressive effects by the combination of Denosumab and Polatuzumab vedotin.	Diffuse large B-cell lymphoma [2A81]	[6]
Axicabtagene ciloleucel	DMYHN59	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Axicabtagene ciloleucel.	Diffuse large B-cell lymphoma [2A81]	[6]
Bay 80-6946	DMLOS5R	Moderate	Additive myelosuppressive effects by the combination of Denosumab and Bay 80-6946.	Follicular lymphoma [2A80]	[6]
Avapritinib	DMK2GZX	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Avapritinib.	Gastrointestinal stromal tumour [2B5B]	[6]
177Lu-DOTATATE	DMT8GVU	Moderate	Additive immunosuppressive effects by the combination of Denosumab and 177Lu-DOTATATE.	Hepatitis virus infection [1E50-1E51]	[6]
Brentuximab vedotin	DMWLC57	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Brentuximab vedotin.	Hodgkin lymphoma [2B30]	[7]
Teriflunomide	DMQ2FKJ	Moderate	Additive myelosuppressive effects by the combination of Denosumab and Teriflunomide.	Hyper-lipoproteinaemia [5C80]	[6]
Etelcalcetide	DMHP9BL	Major	Increased risk of hypocalcemia by the combination of Denosumab and Etelcalcetide.	Hyper-parathyroidism [5A51]	[8]
Brigatinib	DM7W94S	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Brigatinib.	Lung cancer [2C25]	[6]
Lurbinectedin	DMEFRTZ	Moderate	Additive myelosuppressive effects by the combination of Denosumab and Lurbinectedin.	Lung cancer [2C25]	[6]
Osimertinib	DMRJLAT	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Osimertinib.	Lung cancer [2C25]	[6]
Belimumab	DM3OBQF	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Belimumab.	Lupus erythematosus [4A40]	[6]
Ofatumumab	DM295PR	Moderate	Additive myelosuppressive effects by the combination of Denosumab and Ofatumumab.	Mature B-cell leukaemia [2A82]	[6]
Obinutuzumab	DM3BVAE	Moderate	Additive myelosuppressive effects by the combination of Denosumab and Obinutuzumab.	Mature B-cell leukaemia [2A82]	[6]
Idelalisib	DM602WT	Moderate	Additive myelosuppressive effects by the combination of Denosumab and Idelalisib.	Mature B-cell leukaemia [2A82]	[6]
GDC-0199	DMH0QKA	Moderate	Additive immunosuppressive effects by the combination of Denosumab and GDC-0199.	Mature B-cell leukaemia [2A82]	[6]
IPI-145	DMWA24P	Moderate	Additive myelosuppressive effects by the combination of Denosumab and IPI-145.	Mature B-cell leukaemia [2A82]	[6]
Acalabrutinib	DM7GCVW	Moderate	Additive myelosuppressive effects by the combination of Denosumab and Acalabrutinib.	Mature B-cell lymphoma [2A85]	[6]
Blinatumomab	DMGECIJ	Moderate	Additive myelosuppressive effects by the combination of Denosumab and Blinatumomab.	Mature B-cell lymphoma [2A85]	[6]
Ibrutinib	DMHZCPO	Moderate	Additive myelosuppressive effects by the combination of Denosumab and Ibrutinib.	Mature B-cell lymphoma [2A85]	[6]
Tisagenlecleucel	DMM9BJD	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Tisagenlecleucel.	Mature B-cell lymphoma [2A85]	[6]
Ponatinib	DMYGJQO	Moderate	Additive myelosuppressive effects by the combination of Denosumab and Ponatinib.	Mature B-cell lymphoma [2A85]	[6]
Carfilzomib	DM48K0X	Moderate	Additive myelosuppressive effects by the combination of Denosumab and Carfilzomib.	Multiple myeloma [2A83]	[6]
Selinexor	DMBD4K3	Moderate	Additive myelosuppressive effects by the combination of Denosumab and Selinexor.	Multiple myeloma [2A83]	[6]
Belantamab mafodotin	DMBT3AI	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Belantamab mafodotin.	Multiple myeloma [2A83]	[6]
Daratumumab	DMKCIUZ	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Daratumumab.	Multiple myeloma [2A83]	[6]
Tecfidera	DM2OVDT	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Tecfidera.	Multiple sclerosis [8A40]	[6]
Siponimod	DM2R86O	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Siponimod.	Multiple sclerosis [8A40]	[6]
Fingolimod	DM5JVAN	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Fingolimod.	Multiple sclerosis [8A40]	[6]
Ocrelizumab	DMEZ2KH	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Ocrelizumab.	Multiple sclerosis [8A40]	[6]
Deflazacort	DMV0RNS	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Deflazacort.	Muscular dystrophy [8C70]	[6]
Ruxolitinib	DM7Q98D	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Ruxolitinib.	Myeloproliferative neoplasm [2A20]	[6]
Inebilizumab	DMI0RHA	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Inebilizumab.	Nervous system paraneoplastic/autoimmune disorder [8E4A]	[6]
Atezolizumab	DMMF8U0	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Atezolizumab.	Non-small cell lung cancer [2C25]	[6]
Olaparib	DM8QB1D	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Olaparib.	Ovarian cancer [2C73]	[6]
Rucaparib	DM9PVX8	Moderate	Additive myelosuppressive effects by the combination of Denosumab and Rucaparib.	Ovarian cancer [2C73]	[6]
MK-4827	DMLYGH4	Moderate	Additive immunosuppressive effects by the combination of Denosumab and MK-4827.	Ovarian cancer [2C73]	[6]
Brodalumab	DMASDQ6	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Brodalumab.	Psoriasis [EA90]	[6]
Tildrakizumab	DMLW9HG	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Tildrakizumab.	Psoriasis [EA90]	[6]
Risankizumab	DMM32GT	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Risankizumab.	Psoriasis [EA90]	[6]
Ixekizumab	DMXW92T	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Ixekizumab.	Psoriasis [EA90]	[6]
Upadacitinib	DM32B5U	Moderate	Additive myelosuppressive effects by the combination of Denosumab and Upadacitinib.	Rheumatoid arthritis [FA20]	[6]
Baricitinib	DM4ONW5	Moderate	Additive myelosuppressive effects by the combination of Denosumab and Baricitinib.	Rheumatoid arthritis [FA20]	[6]
Tofacitinib	DMBS370	Moderate	Additive myelosuppressive effects by the combination of Denosumab and Tofacitinib.	Rheumatoid arthritis [FA20]	[6]
Golimumab	DMHZV7X	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Golimumab.	Rheumatoid arthritis [FA20]	[6]
Sarilumab	DMOGNXY	Moderate	Additive myelosuppressive effects by the combination of Denosumab and Sarilumab.	Rheumatoid arthritis [FA20]	[6]
Mogamulizumab	DMISH0Z	Moderate	Additive myelosuppressive effects by the combination of Denosumab and Mogamulizumab.	Sezary syndrome [2B02]	[6]
LEE011	DMMX75K	Moderate	Additive myelosuppressive effects by the combination of Denosumab and LEE011.	Solid tumour/cancer [2A00-2F9Z]	[6]
Pomalidomide	DMTGBAX	Moderate	Additive myelosuppressive effects by the combination of Denosumab and Pomalidomide.	Systemic sclerosis [4A42]	[6]
Plicamycin	DM7C8YV	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Plicamycin.	Testicular cancer [2C80]	[6]
Belatacept	DMXLYQF	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Belatacept.	Transplant rejection [NE84]	[6]
Durvalumab	DM4PVDY	Moderate	Additive immunosuppressive effects by the combination of Denosumab and Durvalumab.	Ureteral cancer [2C92]	[6]
-----------


⏷ Show the Full List of 61 DDI Information of This Drug

References

1	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6886).
2	Mullard A: 2010 FDA drug approvals. Nat Rev Drug Discov. 2011 Feb;10(2):82-5.
3	Trend Analysis of a Database of Intravenous Pharmacokinetic Parameters in Humans for 1352 Drug Compounds
4	This week in therapeutics Cancer. SciBX 3(40); doi:10.1038/scibx.2010.1202. Oct. 14, 2010
5	Clinical pipeline report, company report or official report of Ablynx.
6	Product Information. Prolia (denosumab). Amgen USA, Thousand Oaks, CA.
7	Product Information. Lonsurf (tipiracil-trifluridine). Taiho Oncology, Inc., Princeton, NJ.
8	Cerner Multum, Inc. "Australian Product Information.".