Details of the Drug

General Information of Drug (ID: DMGLUQS)

Drug Name

Rilonacept

Synonyms

Rilonacept (USAN/INN)

Indication

Disease Entry	ICD 11	Status	REF
Arthritis	FA20	Approved	[1], [2]
Acute gout flare	FA25.0	Phase 3	[1], [3]

Sequence

SERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYSTAHSAGLTLIWYWTRQDRDLE
EPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNS
PMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMGCYKIQNFNNVIPEGMNLSFL
IALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNAVPPVIHSPNDHVVYEKEPGE
ELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINESISHSRTEDETRTQILSIKK
VTSEDLKRSYVCHARSAKGEVAKAAKVKQKVPAPRYTVEKCKEREEKIILVSSANEIDVR
PCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSS
YCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYK
DCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENK
PTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVE
NPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNSGDKTHTCP
PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNA
KTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQ
VYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY
SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

ADMET Property

Half-life: The concentration or amount of drug in body reduced by one-half in 8.6 days [4]

Cross-matching ID

DrugBank ID: DB06372
TTD ID: D09DBY

Molecular Interaction Atlas of This Drug

Drug Therapeutic Target (DTT)

DTT Name	DTT ID	UniProt ID	MOA	REF
Interleukin-1 beta (IL1B)	TTRYK0X	IL1B_HUMAN	Modulator	[2]

------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

The Studied Disease

Arthritis

ICD Disease Classification

FA20

Molecule Name	Molecule Type	Gene Name	p-value	Fold-Change	Z-score
Interleukin-1 beta (IL1B)	DTT	IL1B	4.74E-01	8.78E-03	0.02

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Same Disease as Rilonacept

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Disease	REF
Golimumab	DMHZV7X	Major	Additive immunosuppressive effects by the combination of Rilonacept and Golimumab.	Rheumatoid arthritis [FA20]	[15]
-----------

Coadministration of a Drug Treating the Disease Different from Rilonacept (Comorbidity)

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Comorbidity	REF
Midostaurin	DMI6E0R	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Midostaurin.	Acute myeloid leukaemia [2A60]	[16]
Oliceridine	DM6MDCF	Moderate	Altered metabolism of Rilonacept due to Oliceridine alters the formation of CYP450 enzymes.	Acute pain [MG31]	[17]
Siltuximab	DMGEATB	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Siltuximab.	Anemia [3A00-3A9Z]	[16]
Dupilumab	DMOAD2Y	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Dupilumab.	Atopic eczema [EA80]	[16]
Eribulin	DM1DX4Q	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Eribulin.	Breast cancer [2C60-2C6Y]	[16]
Talazoparib	DM1KS78	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Talazoparib.	Breast cancer [2C60-2C6Y]	[16]
LY2835219	DM93VBZ	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and LY2835219.	Breast cancer [2C60-2C6Y]	[16]
Pralatrexate	DMAO80I	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Pralatrexate.	Breast cancer [2C60-2C6Y]	[16]
Palbociclib	DMD7L94	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Palbociclib.	Breast cancer [2C60-2C6Y]	[16]
Cabazitaxel	DMPAZHC	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Cabazitaxel.	Breast cancer [2C60-2C6Y]	[16]
Bosutinib	DMTI8YE	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Bosutinib.	Breast cancer [2C60-2C6Y]	[16]
Aflibercept	DMT3D5I	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Aflibercept.	Colorectal cancer [2B91]	[16]
Levonorgestrel	DM1DP7T	Moderate	Altered metabolism of Rilonacept due to Levonorgestrel alters the formation of CYP450 enzymes.	Contraceptive management [QA21]	[17]
Polatuzumab vedotin	DMF6Y0L	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Polatuzumab vedotin.	Diffuse large B-cell lymphoma [2A81]	[16]
Lisocabtagene maraleucel	DMP45ME	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Lisocabtagene maraleucel.	Diffuse large B-cell lymphoma [2A81]	[16]
Axicabtagene ciloleucel	DMYHN59	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Axicabtagene ciloleucel.	Diffuse large B-cell lymphoma [2A81]	[16]
Oestradiol valerate and dienogest	DMZK0FQ	Moderate	Altered metabolism of Rilonacept due to Oestradiol valerate and dienogest alters the formation of CYP450 enzymes.	Endometriosis [GA10]	[18]
Bay 80-6946	DMLOS5R	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Bay 80-6946.	Follicular lymphoma [2A80]	[16]
Avapritinib	DMK2GZX	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Avapritinib.	Gastrointestinal stromal tumour [2B5B]	[16]
177Lu-DOTATATE	DMT8GVU	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and 177Lu-DOTATATE.	Hepatitis virus infection [1E50-1E51]	[16]
Brentuximab vedotin	DMWLC57	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Brentuximab vedotin.	Hodgkin lymphoma [2B30]	[16]
Teriflunomide	DMQ2FKJ	Major	Additive immunosuppressive effects by the combination of Rilonacept and Teriflunomide.	Hyper-lipoproteinaemia [5C80]	[19]
Levamlodipine	DM92S6N	Moderate	Altered metabolism of Rilonacept due to Levamlodipine alters the formation of CYP450 enzymes.	Hypertension [BA00-BA04]	[17]
Denosumab	DMNI0KO	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Denosumab.	Low bone mass disorder [FB83]	[20]
Brigatinib	DM7W94S	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Brigatinib.	Lung cancer [2C25]	[16]
Lurbinectedin	DMEFRTZ	Moderate	Additive myelosuppressive effects by the combination of Rilonacept and Lurbinectedin.	Lung cancer [2C25]	[17]
Osimertinib	DMRJLAT	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Osimertinib.	Lung cancer [2C25]	[16]
Belimumab	DM3OBQF	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Belimumab.	Lupus erythematosus [4A40]	[16]
Ofatumumab	DM295PR	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Ofatumumab.	Mature B-cell leukaemia [2A82]	[16]
Obinutuzumab	DM3BVAE	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Obinutuzumab.	Mature B-cell leukaemia [2A82]	[16]
Idelalisib	DM602WT	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Idelalisib.	Mature B-cell leukaemia [2A82]	[16]
GDC-0199	DMH0QKA	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and GDC-0199.	Mature B-cell leukaemia [2A82]	[16]
IPI-145	DMWA24P	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and IPI-145.	Mature B-cell leukaemia [2A82]	[16]
Acalabrutinib	DM7GCVW	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Acalabrutinib.	Mature B-cell lymphoma [2A85]	[16]
Blinatumomab	DMGECIJ	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Blinatumomab.	Mature B-cell lymphoma [2A85]	[16]
Ibrutinib	DMHZCPO	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Ibrutinib.	Mature B-cell lymphoma [2A85]	[16]
Tisagenlecleucel	DMM9BJD	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Tisagenlecleucel.	Mature B-cell lymphoma [2A85]	[16]
Ponatinib	DMYGJQO	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Ponatinib.	Mature B-cell lymphoma [2A85]	[16]
Carfilzomib	DM48K0X	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Carfilzomib.	Multiple myeloma [2A83]	[16]
Panobinostat	DM58WKG	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Panobinostat.	Multiple myeloma [2A83]	[16]
Selinexor	DMBD4K3	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Selinexor.	Multiple myeloma [2A83]	[16]
Belantamab mafodotin	DMBT3AI	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Belantamab mafodotin.	Multiple myeloma [2A83]	[16]
Daratumumab	DMKCIUZ	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Daratumumab.	Multiple myeloma [2A83]	[16]
Tecfidera	DM2OVDT	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Tecfidera.	Multiple sclerosis [8A40]	[16]
Siponimod	DM2R86O	Major	Additive immunosuppressive effects by the combination of Rilonacept and Siponimod.	Multiple sclerosis [8A40]	[15]
Fingolimod	DM5JVAN	Major	Additive immunosuppressive effects by the combination of Rilonacept and Fingolimod.	Multiple sclerosis [8A40]	[21]
Ocrelizumab	DMEZ2KH	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Ocrelizumab.	Multiple sclerosis [8A40]	[16]
Ozanimod	DMT6AM2	Major	Additive immunosuppressive effects by the combination of Rilonacept and Ozanimod.	Multiple sclerosis [8A40]	[17]
Deflazacort	DMV0RNS	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Deflazacort.	Muscular dystrophy [8C70]	[16]
Ruxolitinib	DM7Q98D	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Ruxolitinib.	Myeloproliferative neoplasm [2A20]	[16]
Inebilizumab	DMI0RHA	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Inebilizumab.	Nervous system paraneoplastic/autoimmune disorder [8E4A]	[16]
Atezolizumab	DMMF8U0	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Atezolizumab.	Non-small cell lung cancer [2C25]	[16]
Olaparib	DM8QB1D	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Olaparib.	Ovarian cancer [2C73]	[16]
Rucaparib	DM9PVX8	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Rucaparib.	Ovarian cancer [2C73]	[16]
MK-4827	DMLYGH4	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and MK-4827.	Ovarian cancer [2C73]	[16]
Brodalumab	DMASDQ6	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Brodalumab.	Psoriasis [EA90]	[16]
Tildrakizumab	DMLW9HG	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Tildrakizumab.	Psoriasis [EA90]	[16]
Risankizumab	DMM32GT	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Risankizumab.	Psoriasis [EA90]	[16]
Ixekizumab	DMXW92T	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Ixekizumab.	Psoriasis [EA90]	[16]
Anthrax vaccine	DM9GSWY	Moderate	Antagonize the effect of Rilonacept when combined with Anthrax vaccine.	Sepsis [1G40-1G41]	[22]
Mogamulizumab	DMISH0Z	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Mogamulizumab.	Sezary syndrome [2B02]	[16]
LEE011	DMMX75K	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and LEE011.	Solid tumour/cancer [2A00-2F9Z]	[16]
Pomalidomide	DMTGBAX	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Pomalidomide.	Systemic sclerosis [4A42]	[16]
Plicamycin	DM7C8YV	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Plicamycin.	Testicular cancer [2C80]	[16]
Apixaban	DM89JLN	Moderate	Altered metabolism of Rilonacept due to Apixaban alters the formation of CYP450 enzymes.	Thrombosis [DB61-GB90]	[17]
Belatacept	DMXLYQF	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Belatacept.	Transplant rejection [NE84]	[16]
Durvalumab	DM4PVDY	Moderate	Additive immunosuppressive effects by the combination of Rilonacept and Durvalumab.	Ureteral cancer [2C92]	[16]
-----------


⏷ Show the Full List of 67 DDI Information of This Drug

References

1	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6790).
2	2008 FDA drug approvals. Nat Rev Drug Discov. 2009 Feb;8(2):93-6.
3	New relief for gout. Nat Biotechnol. 2009 Apr;27(4):309-11.
4	Trend Analysis of a Database of Intravenous Pharmacokinetic Parameters in Humans for 1352 Drug Compounds
5	Glucosamine inhibits IL-1beta-mediated IL-8 production in prostate cancer cells by MAPK attenuation. J Cell Biochem. 2009 Oct 1;108(2):489-98.
6	Elimination of arthritis pain and inflammation for over 2 years with a single 90 min, topical 14% gallium nitrate treatment: case reports and revie... Med Hypotheses. 2005;65(6):1136-41.
7	Hughes B: 2009 FDA drug approvals. Nat Rev Drug Discov. 2010 Feb;9(2):89-92.
8	Non-surgical treatment of osteoarthritis of large joints - new aspects. Wien Med Wochenschr. 2009;159(3-4):76-86.
9	Gevokizumab, an anti-IL-1beta mAb for the potential treatment of type 1 and 2 diabetes, rheumatoid arthritis and cardiovascular disease. Curr Opin Mol Ther. 2010 Dec;12(6):755-69.
10	Generation and characterization of ABT-981, a dual variable domain immunoglobulin (DVD-Ig(TM)) molecule that specifically and potently neutralizes both IL-1alpha and IL-1beta. MAbs. 2015;7(3):605-19.
11	Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
12	Double-blind, randomized study evaluating the glycemic and anti-inflammatory effects of subcutaneous LY2189102, a neutralizing IL-1beta antibody, in patients with type 2 diabetes. Diabetes Care. 2013Aug;36(8):2239-46.
13	A Swell in the Armamentarium of Antiepileptic Drug Targets. Epilepsy Curr. 2011 Nov-Dec; 11(6): 172-176.
14	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2623).
15	Cerner Multum, Inc. "Australian Product Information.".
16	Product Information. Arcalyst (rilonacept). Regeneron Pharmaceuticals Inc, Tarrytown, NY.
17	Cerner Multum, Inc. "UK Summary of Product Characteristics.".
18	Product Information. Cosentyx (secukinumab). Novartis Pharmaceuticals, East Hanover, NJ.
19	Product Information. Arava (leflunomide). Hoechst Marion-Roussel Inc, Kansas City, MO.
20	Product Information. Prolia (denosumab). Amgen USA, Thousand Oaks, CA.
21	Product Information. Gilenya (fingolimod). Novartis Pharmaceuticals, East Hanover, NJ.
22	CDC. Centers for Disease Control and Prevention/ "Recommendations of the advisory committtee on immunization practices (ACIP): use of vaccines and immune globulins in persons with altered immunocompetence." MMWR Morb Mortal Wkly Rep 42(RR-04) (1993): 1-18. [PMID: 20300058]