Details of the Drug

General Information of Drug (ID: DMGLUQS)

Drug Name
Rilonacept
Synonyms Rilonacept (USAN/INN)
Indication
Disease Entry ICD 11 Status REF
Arthritis FA20 Approved [1]
Acute gout flare FA25.0 Phase 3 [1]
Sequence
SERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYSTAHSAGLTLIWYWTRQDRDLE
EPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNS
PMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMGCYKIQNFNNVIPEGMNLSFL
IALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNAVPPVIHSPNDHVVYEKEPGE
ELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINESISHSRTEDETRTQILSIKK
VTSEDLKRSYVCHARSAKGEVAKAAKVKQKVPAPRYTVEKCKEREEKIILVSSANEIDVR
PCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSS
YCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYK
DCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENK
PTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVE
NPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNSGDKTHTCP
PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNA
KTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQ
VYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY
SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
ADMET Property
Half-life
The concentration or amount of drug in body reduced by one-half in 8.6 days [2]
Cross-matching ID
DrugBank ID
DB06372
TTD ID
D09DBY
Repurposed Drugs (RPD) Click to Jump to the Detailed RPD Information of This Drug

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
Interleukin-1 beta (IL1B) TTRYK0X IL1B_HUMAN Modulator [3]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

The Studied Disease Arthritis
ICD Disease Classification FA20
Molecule Name Molecule Type Gene Name p-value Fold-Change Z-score
Interleukin-1 beta (IL1B) DTT IL1B 4.74E-01 8.78E-03 0.02
Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Same Disease as Rilonacept
DDI Drug Name DDI Drug ID Severity Mechanism Disease REF
Golimumab DMHZV7X Major Additive immunosuppressive effects by the combination of Rilonacept and Golimumab. Rheumatoid arthritis [FA20] [4]
Coadministration of a Drug Treating the Disease Different from Rilonacept (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Midostaurin DMI6E0R Moderate Additive immunosuppressive effects by the combination of Rilonacept and Midostaurin. Acute myeloid leukaemia [2A60] [5]
Oliceridine DM6MDCF Moderate Altered metabolism of Rilonacept due to Oliceridine alters the formation of CYP450 enzymes. Acute pain [MG31] [6]
Siltuximab DMGEATB Moderate Additive immunosuppressive effects by the combination of Rilonacept and Siltuximab. Anemia [3A00-3A9Z] [5]
Dupilumab DMOAD2Y Moderate Additive immunosuppressive effects by the combination of Rilonacept and Dupilumab. Atopic eczema [EA80] [5]
Eribulin DM1DX4Q Moderate Additive immunosuppressive effects by the combination of Rilonacept and Eribulin. Breast cancer [2C60-2C6Y] [5]
Talazoparib DM1KS78 Moderate Additive immunosuppressive effects by the combination of Rilonacept and Talazoparib. Breast cancer [2C60-2C6Y] [5]
LY2835219 DM93VBZ Moderate Additive immunosuppressive effects by the combination of Rilonacept and LY2835219. Breast cancer [2C60-2C6Y] [5]
Pralatrexate DMAO80I Moderate Additive immunosuppressive effects by the combination of Rilonacept and Pralatrexate. Breast cancer [2C60-2C6Y] [5]
Palbociclib DMD7L94 Moderate Additive immunosuppressive effects by the combination of Rilonacept and Palbociclib. Breast cancer [2C60-2C6Y] [5]
Cabazitaxel DMPAZHC Moderate Additive immunosuppressive effects by the combination of Rilonacept and Cabazitaxel. Breast cancer [2C60-2C6Y] [5]
Bosutinib DMTI8YE Moderate Additive immunosuppressive effects by the combination of Rilonacept and Bosutinib. Breast cancer [2C60-2C6Y] [5]
Aflibercept DMT3D5I Moderate Additive immunosuppressive effects by the combination of Rilonacept and Aflibercept. Colorectal cancer [2B91] [5]
Levonorgestrel DM1DP7T Moderate Altered metabolism of Rilonacept due to Levonorgestrel alters the formation of CYP450 enzymes. Contraceptive management [QA21] [6]
Polatuzumab vedotin DMF6Y0L Moderate Additive immunosuppressive effects by the combination of Rilonacept and Polatuzumab vedotin. Diffuse large B-cell lymphoma [2A81] [5]
Lisocabtagene maraleucel DMP45ME Moderate Additive immunosuppressive effects by the combination of Rilonacept and Lisocabtagene maraleucel. Diffuse large B-cell lymphoma [2A81] [5]
Axicabtagene ciloleucel DMYHN59 Moderate Additive immunosuppressive effects by the combination of Rilonacept and Axicabtagene ciloleucel. Diffuse large B-cell lymphoma [2A81] [5]
Oestradiol valerate and dienogest DMZK0FQ Moderate Altered metabolism of Rilonacept due to Oestradiol valerate and dienogest alters the formation of CYP450 enzymes. Endometriosis [GA10] [7]
Bay 80-6946 DMLOS5R Moderate Additive immunosuppressive effects by the combination of Rilonacept and Bay 80-6946. Follicular lymphoma [2A80] [5]
Avapritinib DMK2GZX Moderate Additive immunosuppressive effects by the combination of Rilonacept and Avapritinib. Gastrointestinal stromal tumour [2B5B] [5]
177Lu-DOTATATE DMT8GVU Moderate Additive immunosuppressive effects by the combination of Rilonacept and 177Lu-DOTATATE. Hepatitis virus infection [1E50-1E51] [5]
Brentuximab vedotin DMWLC57 Moderate Additive immunosuppressive effects by the combination of Rilonacept and Brentuximab vedotin. Hodgkin lymphoma [2B30] [5]
Teriflunomide DMQ2FKJ Major Additive immunosuppressive effects by the combination of Rilonacept and Teriflunomide. Hyper-lipoproteinaemia [5C80] [8]
Levamlodipine DM92S6N Moderate Altered metabolism of Rilonacept due to Levamlodipine alters the formation of CYP450 enzymes. Hypertension [BA00-BA04] [6]
Denosumab DMNI0KO Moderate Additive immunosuppressive effects by the combination of Rilonacept and Denosumab. Low bone mass disorder [FB83] [9]
Brigatinib DM7W94S Moderate Additive immunosuppressive effects by the combination of Rilonacept and Brigatinib. Lung cancer [2C25] [5]
Lurbinectedin DMEFRTZ Moderate Additive myelosuppressive effects by the combination of Rilonacept and Lurbinectedin. Lung cancer [2C25] [6]
Osimertinib DMRJLAT Moderate Additive immunosuppressive effects by the combination of Rilonacept and Osimertinib. Lung cancer [2C25] [5]
Belimumab DM3OBQF Moderate Additive immunosuppressive effects by the combination of Rilonacept and Belimumab. Lupus erythematosus [4A40] [5]
Ofatumumab DM295PR Moderate Additive immunosuppressive effects by the combination of Rilonacept and Ofatumumab. Mature B-cell leukaemia [2A82] [5]
Obinutuzumab DM3BVAE Moderate Additive immunosuppressive effects by the combination of Rilonacept and Obinutuzumab. Mature B-cell leukaemia [2A82] [5]
Idelalisib DM602WT Moderate Additive immunosuppressive effects by the combination of Rilonacept and Idelalisib. Mature B-cell leukaemia [2A82] [5]
GDC-0199 DMH0QKA Moderate Additive immunosuppressive effects by the combination of Rilonacept and GDC-0199. Mature B-cell leukaemia [2A82] [5]
IPI-145 DMWA24P Moderate Additive immunosuppressive effects by the combination of Rilonacept and IPI-145. Mature B-cell leukaemia [2A82] [5]
Acalabrutinib DM7GCVW Moderate Additive immunosuppressive effects by the combination of Rilonacept and Acalabrutinib. Mature B-cell lymphoma [2A85] [5]
Blinatumomab DMGECIJ Moderate Additive immunosuppressive effects by the combination of Rilonacept and Blinatumomab. Mature B-cell lymphoma [2A85] [5]
Ibrutinib DMHZCPO Moderate Additive immunosuppressive effects by the combination of Rilonacept and Ibrutinib. Mature B-cell lymphoma [2A85] [5]
Tisagenlecleucel DMM9BJD Moderate Additive immunosuppressive effects by the combination of Rilonacept and Tisagenlecleucel. Mature B-cell lymphoma [2A85] [5]
Ponatinib DMYGJQO Moderate Additive immunosuppressive effects by the combination of Rilonacept and Ponatinib. Mature B-cell lymphoma [2A85] [5]
Carfilzomib DM48K0X Moderate Additive immunosuppressive effects by the combination of Rilonacept and Carfilzomib. Multiple myeloma [2A83] [5]
Panobinostat DM58WKG Moderate Additive immunosuppressive effects by the combination of Rilonacept and Panobinostat. Multiple myeloma [2A83] [5]
Selinexor DMBD4K3 Moderate Additive immunosuppressive effects by the combination of Rilonacept and Selinexor. Multiple myeloma [2A83] [5]
Belantamab mafodotin DMBT3AI Moderate Additive immunosuppressive effects by the combination of Rilonacept and Belantamab mafodotin. Multiple myeloma [2A83] [5]
Daratumumab DMKCIUZ Moderate Additive immunosuppressive effects by the combination of Rilonacept and Daratumumab. Multiple myeloma [2A83] [5]
Tecfidera DM2OVDT Moderate Additive immunosuppressive effects by the combination of Rilonacept and Tecfidera. Multiple sclerosis [8A40] [5]
Siponimod DM2R86O Major Additive immunosuppressive effects by the combination of Rilonacept and Siponimod. Multiple sclerosis [8A40] [4]
Fingolimod DM5JVAN Major Additive immunosuppressive effects by the combination of Rilonacept and Fingolimod. Multiple sclerosis [8A40] [10]
Ocrelizumab DMEZ2KH Moderate Additive immunosuppressive effects by the combination of Rilonacept and Ocrelizumab. Multiple sclerosis [8A40] [5]
Ozanimod DMT6AM2 Major Additive immunosuppressive effects by the combination of Rilonacept and Ozanimod. Multiple sclerosis [8A40] [6]
Deflazacort DMV0RNS Moderate Additive immunosuppressive effects by the combination of Rilonacept and Deflazacort. Muscular dystrophy [8C70] [5]
Ruxolitinib DM7Q98D Moderate Additive immunosuppressive effects by the combination of Rilonacept and Ruxolitinib. Myeloproliferative neoplasm [2A20] [5]
Inebilizumab DMI0RHA Moderate Additive immunosuppressive effects by the combination of Rilonacept and Inebilizumab. Nervous system paraneoplastic/autoimmune disorder [8E4A] [5]
Atezolizumab DMMF8U0 Moderate Additive immunosuppressive effects by the combination of Rilonacept and Atezolizumab. Non-small cell lung cancer [2C25] [5]
Olaparib DM8QB1D Moderate Additive immunosuppressive effects by the combination of Rilonacept and Olaparib. Ovarian cancer [2C73] [5]
Rucaparib DM9PVX8 Moderate Additive immunosuppressive effects by the combination of Rilonacept and Rucaparib. Ovarian cancer [2C73] [5]
MK-4827 DMLYGH4 Moderate Additive immunosuppressive effects by the combination of Rilonacept and MK-4827. Ovarian cancer [2C73] [5]
Brodalumab DMASDQ6 Moderate Additive immunosuppressive effects by the combination of Rilonacept and Brodalumab. Psoriasis [EA90] [5]
Tildrakizumab DMLW9HG Moderate Additive immunosuppressive effects by the combination of Rilonacept and Tildrakizumab. Psoriasis [EA90] [5]
Risankizumab DMM32GT Moderate Additive immunosuppressive effects by the combination of Rilonacept and Risankizumab. Psoriasis [EA90] [5]
Ixekizumab DMXW92T Moderate Additive immunosuppressive effects by the combination of Rilonacept and Ixekizumab. Psoriasis [EA90] [5]
Anthrax vaccine DM9GSWY Moderate Antagonize the effect of Rilonacept when combined with Anthrax vaccine. Sepsis [1G40-1G41] [11]
Mogamulizumab DMISH0Z Moderate Additive immunosuppressive effects by the combination of Rilonacept and Mogamulizumab. Sezary syndrome [2B02] [5]
LEE011 DMMX75K Moderate Additive immunosuppressive effects by the combination of Rilonacept and LEE011. Solid tumour/cancer [2A00-2F9Z] [5]
Pomalidomide DMTGBAX Moderate Additive immunosuppressive effects by the combination of Rilonacept and Pomalidomide. Systemic sclerosis [4A42] [5]
Plicamycin DM7C8YV Moderate Additive immunosuppressive effects by the combination of Rilonacept and Plicamycin. Testicular cancer [2C80] [5]
Apixaban DM89JLN Moderate Altered metabolism of Rilonacept due to Apixaban alters the formation of CYP450 enzymes. Thrombosis [DB61-GB90] [6]
Belatacept DMXLYQF Moderate Additive immunosuppressive effects by the combination of Rilonacept and Belatacept. Transplant rejection [NE84] [5]
Durvalumab DM4PVDY Moderate Additive immunosuppressive effects by the combination of Rilonacept and Durvalumab. Ureteral cancer [2C92] [5]
⏷ Show the Full List of 67 DDI Information of This Drug

References

1 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6790).
2 Trend Analysis of a Database of Intravenous Pharmacokinetic Parameters in Humans for 1352 Drug Compounds
3 2008 FDA drug approvals. Nat Rev Drug Discov. 2009 Feb;8(2):93-6.
4 Cerner Multum, Inc. "Australian Product Information.".
5 Product Information. Arcalyst (rilonacept). Regeneron Pharmaceuticals Inc, Tarrytown, NY.
6 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
7 Product Information. Cosentyx (secukinumab). Novartis Pharmaceuticals, East Hanover, NJ.
8 Product Information. Arava (leflunomide). Hoechst Marion-Roussel Inc, Kansas City, MO.
9 Product Information. Prolia (denosumab). Amgen USA, Thousand Oaks, CA.
10 Product Information. Gilenya (fingolimod). Novartis Pharmaceuticals, East Hanover, NJ.
11 CDC. Centers for Disease Control and Prevention/ "Recommendations of the advisory committtee on immunization practices (ACIP): use of vaccines and immune globulins in persons with altered immunocompetence." MMWR Morb Mortal Wkly Rep 42(RR-04) (1993): 1-18. [PMID: 20300058]