Details of the Drug

General Information of Drug (ID: DMMF8U0)

Drug Name
Atezolizumab
Indication
Disease Entry ICD 11 Status REF
Non-small cell lung cancer 2C25 Approved [1]
Bladder cancer 2C94 Phase 3 [2]
Breast cancer 2C60-2C65 Phase 3 [2]
Hepatocellular carcinoma 2C12.02 Phase 3 [2]
Ovarian cancer 2C73 Phase 3 [2]
Prostate cancer 2C82.0 Phase 3 [2]
Renal cell carcinoma 2C90 Phase 3 [2]
Small-cell lung cancer 2C25.Y Phase 3 [2]
Squamous cell carcinoma 2B60-2D01 Phase 3 [2]
Urothelial carcinoma 2C92.0 Phase 3 [2]
Acute myeloid leukaemia 2A60 Phase 1 [2]
Colorectal cancer 2B91.Z Phase 1 [2]
Follicular lymphoma 2A80 Phase 1 [2]
Gastric adenocarcinoma 2B72 Phase 1 [2]
Haematological malignancy 2B33.Y Phase 1 [2]
Melanoma 2C30 Phase 1 [3]
Multiple myeloma 2A83 Phase 1 [2]
Myelodysplastic syndrome 2A37 Phase 1 [2]
Pancreatic cancer 2C10 Phase 1 [2]
Solid tumour/cancer 2A00-2F9Z Phase 1 [4], [2]
Bronchioalveolar carcinoma 2C25.0 Phase 0 [5]
Ulcer CA02-CB40 Phase 0 [5]
Drug Type
Monoclonal antibody
Sequence
>heavy chain
EVQLVESGGGLVQPGGSLRLSCAASGFTFSDSWIHWVRQAPGKGLEWVAWISPYGGSTYY
ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARRHWPGGFDYWGQGTLVTVSSAS
TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL
YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPS
VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYAST
YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMT
KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ
GNVFSCSVMHEALHNHYTQKSLSLSPGK
>light chain
DIQMTQSPSSLSASVGDRVTITCRASQDVSTAVAWYQQKPGKAPKLLIYSASFLYSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQYLYHPATFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
ADMET Property
Absorption Cmax
The maximum plasma concentration (Cmax) of drug is 0.27-0.35 mg/L [6]
Clearance
The clearance of drug is 0.200 L/day [7]
Half-life
The concentration or amount of drug in body reduced by one-half in 27 days [7]
Metabolism
The drug is metabolized via the broken down into smaller polypeptides and amino acids [8]
Vd
The volume of distribution (Vd) of drug is 6.91 L [7]
Cross-matching ID
DrugBank ID
DB11595
TTD ID
D0YM2K

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
Programmed cell death 1 ligand 1 (PD-L1) TT8ZLTI PD1L1_HUMAN Not Available [1]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Atezolizumab (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Siponimod DM2R86O Major Additive immunosuppressive effects by the combination of Atezolizumab and Siponimod. Multiple sclerosis [8A40] [18]
Ozanimod DMT6AM2 Major Additive immunosuppressive effects by the combination of Atezolizumab and Ozanimod. Multiple sclerosis [8A40] [19]
Deflazacort DMV0RNS Moderate Additive immunosuppressive effects by the combination of Atezolizumab and Deflazacort. Muscular dystrophy [8C70] [20]

References

1 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2019
2 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
3 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
4 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
5 Development of Inhibitors of the Programmed Cell Death-1/Programmed Cell Death-Ligand 1 Signaling Pathway.J Med Chem. 2019 Feb 28;62(4):1715-1730.
6 Stroh M, Winter H, Marchand M, Claret L, Eppler S, Ruppel J, Abidoye O, Teng SL, Lin WT, Dayog S, Bruno R, Jin J, Girish S: Clinical Pharmacokinetics and Pharmacodynamics of Atezolizumab in Metastatic Urothelial Carcinoma. Clin Pharmacol Ther. 2017 Aug;102(2):305-312. doi: 10.1002/cpt.587. Epub 2017 Jun 9.
7 Atezolizumab: First Global Approval. Drugs. 2016 Aug;76(12):1227-32. doi: 10.1007/s40265-016-0618-8.
8 Li K, Xu Y: Citrate metabolism in blood transfusions and its relationship due to metabolic alkalosis and respiratory acidosis. Int J Clin Exp Med. 2015 Apr 15;8(4):6578-84. eCollection 2015.
9 Antibody-Dependent Cellular Cytotoxicity Activity of a Novel Anti-PD-L1 Antibody Avelumab (MSB0010718C) on Human Tumor Cells. Cancer Immunol Res. 2015 Oct;3(10):1148-57.
10 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
11 PD-1 as a potential target in cancer therapy. Cancer Med. 2013 October; 2(5): 662-673.
12 ClinicalTrials.gov (NCT03403777) Avelumab in Refractory Testicular Germ Cell Cancer.. U.S. National Institutes of Health.
13 Clinical pipeline report, company report or official report of Alphamab Oncology.
14 National Cancer Institute Drug Dictionary (drug id 740856).
15 Targeted immunotherapy for non-small cell lung cancer. World J Clin Oncol. 2014 May 10; 5(2): 39-47.
16 GEMSTONE-301: a phase III clinical trial of CS1001 as consolidation therapy in patients with locally advanced/unresectable (stage III) non-small cell lung cancer (NSCLC) who did not have disease progression after prior concurrent/sequential chemoradiotherapy. Transl Lung Cancer Res. 2020 Oct;9(5):2008-2015.
17 Bintrafusp Alfa, a Bifunctional Fusion Protein Targeting TGF- and PD-L1, in Second-Line Treatment of Patients With NSCLC: Results From an Expansion Cohort of a Phase 1 Trial. J Thorac Oncol. 2020 Jul;15(7):1210-1222.
18 Cerner Multum, Inc. "Australian Product Information.".
19 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
20 Agencia Espaola de Medicamentos y Productos Sanitarios Healthcare "Centro de informacion online de medicamentos de la AEMPS - CIMA.".