Details of the Drug

General Information of Drug (ID: DMNYOIX)

• Drug Name: Olaratumab
• Synonyms: LY3012207

Indication

Disease Entry	ICD 11	Status	REF
Soft tissue sarcoma	2B57	Approved	[1]
Non-small-cell lung cancer	2C25.Y	Phase 1	[2]

• Drug Type: Monoclonal antibody
• Sequence:
  >heavy chain
  QLQLQESGPGLVKPSETLSLTCTVSGGSINSSSYYWGWLRQSPGKGLEWIGSFFYTGSTY
  YNPSLRSRLTISVDTSKNQFSLMLSSVTAADTAVYYCARQSTYYYGSGNYYGWFDRWDQG
  TLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTF
  PAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTHTCPPCP
  APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK
  PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT
  LPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL
  TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
  >light chain
  EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPA
  RFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPPAFGQGTKVEIKRTVAAPSVFIFPP
  SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
  LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
• ADMET Property:
  Clearance: The mean clearance of drug is 0.56 L/day []
  Half-life: The concentration or amount of drug in body reduced by one-half in 11 days [3]
  Metabolism: The drug is metabolized via proteolytic enzymes []
  Vd: The volume of distribution (Vd) of drug is 7.7 L []
• Cross-matching ID:
  DrugBank ID: DB06043
  TTD ID: D09QZS
• Repurposed Drugs (RPD): Click to Jump to the Detailed RPD Information of This Drug

Molecular Interaction Atlas of This Drug

Drug Therapeutic Target (DTT)

DTT Name	DTT ID	UniProt ID	MOA	REF
Platelet-derived growth factor receptor alpha (PDGFRA)	TT8FYO9	PGFRA_HUMAN	Modulator	[4]

Molecular Expression Atlas of This Drug

• The Studied Disease: Soft tissue sarcoma
• ICD Disease Classification: 2B57

Molecule Name	Molecule Type	Gene Name	p-value	Fold-Change	Z-score
Platelet-derived growth factor receptor alpha (PDGFRA)	DTT	PDGFRA	3.46E-01	-0.23	-1.55

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Olaratumab (Comorbidity)

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Comorbidity	REF
Teriflunomide	DMQ2FKJ	Major	Additive immunosuppressive effects by the combination of Olaratumab and Teriflunomide.	Hyper-lipoproteinaemia [5C80]	[5]
Denosumab	DMNI0KO	Moderate	Additive immunosuppressive effects by the combination of Olaratumab and Denosumab.	Low bone mass disorder [FB83]	[6]
Tecfidera	DM2OVDT	Moderate	Additive immunosuppressive effects by the combination of Olaratumab and Tecfidera.	Multiple sclerosis [8A40]	[7]
Siponimod	DM2R86O	Major	Additive immunosuppressive effects by the combination of Olaratumab and Siponimod.	Multiple sclerosis [8A40]	[8]
Fingolimod	DM5JVAN	Major	Additive immunosuppressive effects by the combination of Olaratumab and Fingolimod.	Multiple sclerosis [8A40]	[9]
Ocrelizumab	DMEZ2KH	Moderate	Additive immunosuppressive effects by the combination of Olaratumab and Ocrelizumab.	Multiple sclerosis [8A40]	[10]
Ozanimod	DMT6AM2	Major	Additive immunosuppressive effects by the combination of Olaratumab and Ozanimod.	Multiple sclerosis [8A40]	[11]
Rilonacept	DMGLUQS	Moderate	Additive immunosuppressive effects by the combination of Olaratumab and Rilonacept.	Rheumatoid arthritis [FA20]	[12]
Golimumab	DMHZV7X	Major	Additive immunosuppressive effects by the combination of Olaratumab and Golimumab.	Rheumatoid arthritis [FA20]	[13]
Anthrax vaccine	DM9GSWY	Moderate	Antagonize the effect of Olaratumab when combined with Anthrax vaccine.	Sepsis [1G40-1G41]	[14]

References

• [1] 2016 FDA drug approvals. Nat Rev Drug Discov. 2017 Feb 2;16(2):73-76.
• [2] ClinicalTrials.gov (NCT02377752) A Study of Olaratumab in Japanese Participants With Advanced Cancer. U.S. National Institutes of Health.
• [3] Trend Analysis of a Database of Intravenous Pharmacokinetic Parameters in Humans for 1352 Drug Compounds
• [4] A phase I study of olaratumab, an anti-platelet-derived growth factor receptor alpha (PDGFRalpha) monoclonal antibody, in patients with advanced solid tumors. Cancer Chemother Pharmacol. 2014 Mar;73(3):595-604.
• [5] Product Information. Arava (leflunomide). Hoechst Marion-Roussel Inc, Kansas City, MO.
• [6] Product Information. Prolia (denosumab). Amgen USA, Thousand Oaks, CA.
• [7] Product Information. Vumerity (diroximel fumarate). Alkermes, Inc, Cambridge, MA.
• [8] Cerner Multum, Inc. "Australian Product Information.".
• [9] Product Information. Gilenya (fingolimod). Novartis Pharmaceuticals, East Hanover, NJ.
• [10] Product Information. Ocrevus (ocrelizumab). Genentech, South San Francisco, CA.
• [11] Cerner Multum, Inc. "UK Summary of Product Characteristics.".
• [12] Product Information. Arcalyst (rilonacept). Regeneron Pharmaceuticals Inc, Tarrytown, NY.
• [13] Product Information. Cimzia (certolizumab). UCB Pharma Inc, Smyrna, GA.
• [14] CDC. Centers for Disease Control and Prevention/ "Recommendations of the advisory committtee on immunization practices (ACIP): use of vaccines and immune globulins in persons with altered immunocompetence." MMWR Morb Mortal Wkly Rep 42(RR-04) (1993): 1-18. [PMID: 20300058]