Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT6OEDT)

DTT Name Cannabinoid receptor 1 (CB1)
Synonyms Cannabinoid CB1 receptor; CNR; CB-R; CANN6
Gene Name CNR1
DTT Type
Successful target
 [1]
BioChemical Class
GPCR rhodopsin
UniProt ID
CNR1_HUMAN
TTD ID
T76685
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
KMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIA
VLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVF
HRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLM
WTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWK
AHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLL
AIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQ
PLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Function
Mediates many cannabinoid-induced effects, acting, among others, on food intake, memory loss, gastrointestinal motility, catalepsy, ambulatory activity, anxiety, chronic pain. Signaling typically involves reduction in cyclic AMP. In the hypothalamus, may have a dual effect on mitochondrial respiration depending upon the agonist dose and possibly upon the cell type. Increases respiration at low doses, while decreases respiration at high doses. At high doses, CNR1 signal transduction involves G-protein alpha-i protein activation and subsequent inhibition of mitochondrial soluble adenylate cyclase, decrease in cyclic AMP concentration, inhibition of protein kinase A (PKA)-dependent phosphorylation of specific subunits of the mitochondrial electron transport system, including NDUFS2. In the hypothalamus, inhibits leptin-induced reactive oxygen species (ROS) formation and mediates cannabinoid-induced increase in SREBF1 and FASN gene expression. In response to cannabinoids, drives the release of orexigenic beta-endorphin, but not that of melanocyte-stimulating hormone alpha/alpha-MSH, from hypothalamic POMC neurons, hence promoting food intake. In the hippocampus, regulates cellular respiration and energy production in response to cannabinoids. Involved in cannabinoid-dependent depolarization-induced suppression of inhibition (DSI), a process in which depolarization of CA1 postsynaptic pyramidal neurons mobilizes eCBs, which retrogradely activate presynaptic CB1 receptors, transiently decreasing GABAergic inhibitory neurotransmission. Also reduces excitatory synaptic transmission. In superior cervical ganglions and cerebral vascular smooth muscle cells, inhibits voltage-gated Ca(2+) channels in a constitutive, as well as agonist-dependent manner. In cerebral vascular smooth muscle cells, cannabinoid-induced inhibition of voltage-gated Ca(2+) channels leads to vasodilation and decreased vascular tone. Induces leptin production in adipocytes and reduces LRP2-mediated leptin clearance in the kidney, hence participating in hyperleptinemia. In adipose tissue, CNR1 signaling leads to increased expression of SREBF1, ACACA and FASN genes. In the liver, activation by endocannabinoids leads to increased de novo lipogenesis and reduced fatty acid catabolism, associated with increased expression of SREBF1/SREBP-1, GCK, ACACA, ACACB and FASN genes. May also affect de novo cholesterol synthesis and HDL-cholesteryl ether uptake. Peripherally modulates energy metabolism. In high carbohydrate diet-induced obesity, may decrease the expression of mitochondrial dihydrolipoyl dehydrogenase/DLD in striated muscles, as well as that of selected glucose/ pyruvate metabolic enzymes, hence affecting energy expenditure through mitochondrial metabolism. In response to cannabinoid anandamide, elicits a proinflammatory response in macrophages, which involves NLRP3 inflammasome activation and IL1B and IL18 secretion. In macrophages infiltrating pancreatic islets, this process may participate in the progression of type-2 diabetes and associated loss of pancreatic beta-cells. G-protein coupled receptor for endogenous cannabinoids (eCBs), including N-arachidonoylethanolamide (also called anandamide or AEA) and 2-arachidonoylglycerol (2-AG), as well as phytocannabinoids, such as delta(9)-tetrahydrocannabinol (THC).
KEGG Pathway
Rap1 signaling pathway (hsa04015 )
Neuroactive ligand-receptor interaction (hsa04080 )
Retrograde endocannabinoid signaling (hsa04723 )
Reactome Pathway
G alpha (i) signalling events (R-HSA-418594 )
Class A/1 (Rhodopsin-like receptors) (R-HSA-373076 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
4 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Marinol DM70IK5 Anorexia nervosa cachexia 6B80 Approved [1]
NABILONE DMVRYT2 Insomnia 7A00-7A0Z Approved [2]
Orlistat DMRJSP8 Obesity 5B81 Approved [3]
SR141716A DMCO5JZ Obesity 5B81 Approved [4]
------------------------------------------------------------------------------------
10 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Tebipenem DMVSX6O Urinary tract infection GC08 Phase 3 [5]
AEF0117 DMQ1GH4 Marijuana use disorder 6C41 Phase 2 [6]
Conatumumab DM2UOSN Colorectal cancer 2B91.Z Phase 2 [7]
GW-42004 DMY3KSU Lipid metabolism disorder 5C52.Z Phase 2 [8]
Nimacimab DM21Z68 Diabetic nephropathy GB61.Z Phase 2 [9]
SR-147778 DMNAECP Obesity 5B81 Phase 2 [10]
GFB-024 DM0L401 Diabetic nephropathy GB61.Z Phase 1 [11]
TM38837 DMCFGD4 Metabolic disorder 5C50-5D2Z Phase 1 [12]
V-24343 DMJSX9N Type-2 diabetes 5A11 Phase 1 [13]
ZY01 DMSLPTO Diabetic complication 5A2Y Phase 1 [14]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Clinical Trial Drug(s)
162 Patented Agent(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
1,2,3-triazole derivative 1 DMKHF39 Obesity 5B81 Patented [15]
1,2,3-triazole derivative 2 DMFR23C Obesity 5B81 Patented [15]
1,2,4,5-tetra-substituted imidazole derivative 1 DMLAYG7 Obesity 5B81 Patented [15]
1,2,4,5-tetra-substituted imidazole derivative 2 DMMCYI5 Obesity 5B81 Patented [15]
1,2,4-tri-substituted imidazoline derivative 1 DMMNVZ5 Obesity 5B81 Patented [15]
1,2,4-triazole derivative 1 DME8MN1 Obesity 5B81 Patented [15]
1,2,4-triazole derivative 2 DM91Z8B Obesity 5B81 Patented [15]
1,5-diphenylpyrrolidin-2-one derivative 1 DMZY3HC Obesity 5B81 Patented [15]
1,5-diphenylpyrrolidin-2-one derivative 2 DMBR2Y9 Obesity 5B81 Patented [15]
2-cycloalkyl resorcinol cannabinoid ligand derivative 1 DMLXQET N. A. N. A. Patented [16]
2-cycloalkyl resorcinol cannabinoid ligand derivative 2 DMB65TO N. A. N. A. Patented [16]
4-methyl-4,5-dihydro-1H-pyrazole-3-carboxamide derivative 1 DMNTOZV Obesity 5B81 Patented [15]
Amide derivative 1 DMO64LA Obesity 5B81 Patented [15]
Aminoazetidine derivative 1 DMNI0M1 Obesity 5B81 Patented [15]
Aminoazetidine derivative 2 DMHSNA5 Obesity 5B81 Patented [15]
Aminoazetidine derivative 3 DMOQHA9 Obesity 5B81 Patented [15]
Aminoazetidine derivative 4 DM50E4Y Obesity 5B81 Patented [15]
Aminoazetidine derivative 5 DMYPD4Z Obesity 5B81 Patented [15]
Aminoazetidine derivative 7 DM3LNQG Obesity 5B81 Patented [15]
Aminoazetidine derivative 8 DMLOIHD Obesity 5B81 Patented [15]
Aminoazetidine derivative 9 DMUASHT Obesity 5B81 Patented [15]
Azetidine derivative 1 DMXEFUD Obesity 5B81 Patented [15]
Azetidine derivative 3 DMIKSVG Obesity 5B81 Patented [15]
Azetidine derivative 4 DMXL2V9 Obesity 5B81 Patented [15]
Azetidine-1-carboxamide derivative 1 DMZX8Y0 Obesity 5B81 Patented [15]
Azetidine-1-carboxamide derivative 2 DMONQ4L Obesity 5B81 Patented [15]
Azetidine-1-carboxamide derivative 3 DM2UGK3 Obesity 5B81 Patented [15]
Benzimidazole derivative 1 DML8W16 Obesity 5B81 Patented [15]
Benzimidazole derivative 2 DM4ZUDY Obesity 5B81 Patented [15]
Carbazole-3-carboxamide analog 1 DM3B5RS N. A. N. A. Patented [16]
Carboxamide derivative 1 DM5GEBH Obesity 5B81 Patented [15]
Cyano(dimethyl)methyl isoxazoles and [1,3,4]-thiadiazoles derivative 1 DMMX1ZE N. A. N. A. Patented [16]
Cyano(dimethyl)methyl isoxazoles and [1,3,4]-thiadiazoles derivative 2 DM6GTDM N. A. N. A. Patented [16]
Diaryl morpholine derivative 1 DMIQOY7 Obesity 5B81 Patented [15]
Diaryl piperazine derivative 1 DMERQ7V Obesity 5B81 Patented [15]
Diaryl piperazine derivative 2 DMDOB20 Obesity 5B81 Patented [15]
Diphenyl purine derivative 1 DM2DYMS Obesity 5B81 Patented [15]
Diphenyl purine derivative 2 DMG8MCJ Obesity 5B81 Patented [15]
Diphenyl purine derivative 3 DMY5CFW Obesity 5B81 Patented [15]
Diphenyl purine derivative 4 DMP3JF4 Obesity 5B81 Patented [15]
Diphenyl purine derivative 5 DMC2T4H Obesity 5B81 Patented [15]
Furopyridine derivative 1 DM2QXVW Obesity 5B81 Patented [15]
Furopyridine derivative 2 DMEU3J9 Obesity 5B81 Patented [15]
Heterocyclic-substituted 3-alkyl azetidine derivative 1 DMJEX3D Obesity 5B81 Patented [15]
Heterocyclic-substituted 3-alkyl azetidine derivative 2 DMEX7PV Obesity 5B81 Patented [15]
Heterocyclic-substituted 3-alkyl azetidine derivative 3 DMO1Y30 Obesity 5B81 Patented [15]
Hydrazide derivative 1 DMUA740 Obesity 5B81 Patented [15]
Imidazole derivative 1 DM14KHX Obesity 5B81 Patented [15]
Imidazole derivative 2 DM8GCVO Obesity 5B81 Patented [15]
Imidazole derivative 3 DMV1ER2 Obesity 5B81 Patented [15]
Imidazole derivative 4 DMPGMX2 Obesity 5B81 Patented [15]
Imidazole derivative 5 DMVSXUM Obesity 5B81 Patented [15]
Imidazole derivative 6 DMOXHZJ Obesity 5B81 Patented [15]
Imidazole derivative 7 DMLPQ7E Obesity 5B81 Patented [15]
Imidazolidine-2,4-dione derivative 1 DMUFSQ2 Obesity 5B81 Patented [15]
Imidazolidine-2,4-dione derivative 2 DMVMD2O Obesity 5B81 Patented [15]
N,N-methylenebis-2-phenylacetamide and benzenesulfonamide derivative 2 DMD4CU5 Osteoporosis FB83.0 Patented [16]
N,N-methylenebis-2-phenylacetamide and benzenesulfonamide derivative 3 DMM78VS Osteoporosis FB83.0 Patented [16]
N-(arylalkyl)-1H-indole-2-sulfonic acid amide derivative 1 DM6TYM0 Obesity 5B81 Patented [15]
N-(arylalkyl)-1H-indole-2-sulfonic acid amide derivative 2 DM2MPN0 Obesity 5B81 Patented [15]
N-phenyl-5-phenyl-pyrazolin-3-yl amide derivative 1 DM9A8L5 Obesity 5B81 Patented [15]
N-phenyl-5-phenyl-pyrazolin-3-yl amide derivative 2 DM8T2LV Obesity 5B81 Patented [15]
N-phenyl-5-phenyl-pyrazolin-3-yl amide derivative 3 DMEH0RC Obesity 5B81 Patented [15]
Phytocannabinoid/aminoalkylindole derivative 1 DMM9F8D N. A. N. A. Patented [16]
Phytocannabinoid/aminoalkylindole derivative 2 DMOXJ7Q N. A. N. A. Patented [16]
Piperazine derivative 1 DMJ7F1Q Obesity 5B81 Patented [15]
Piperazine derivative 2 DM4JZ2T Obesity 5B81 Patented [15]
PMID26161824-Compound-68 DMF9C4I Obesity 5B81 Patented [15]
PMID26161824-Compound-69 DMKOSN5 Obesity 5B81 Patented [15]
PMID27215781-Compound-1 DM84RES N. A. N. A. Patented [16]
PMID27215781-Compound-2 DMBOX0K N. A. N. A. Patented [16]
PMID27215781-Compound-37 DM0L68P Prostate cancer 2C82.0 Patented [16]
Purine derivative 1 DMB65Z4 Obesity 5B81 Patented [15]
Purine derivative 2 DMNRG0P Obesity 5B81 Patented [15]
Purine derivative 3 DMPI2S9 Obesity 5B81 Patented [15]
Pyrano[2,3-b]pyridine derivative 1 DMMVG2O Obesity 5B81 Patented [15]
Pyrano[2,3-b]pyridine derivative 2 DMOJ8P1 Obesity 5B81 Patented [15]
Pyrazole derivative 1 DM3R9PL Obesity 5B81 Patented [15]
Pyrazole derivative 11 DMH7PGU Obesity 5B81 Patented [15]
Pyrazole derivative 12 DM7LFNG Obesity 5B81 Patented [15]
Pyrazole derivative 13 DM5S3L0 Obesity 5B81 Patented [15]
Pyrazole derivative 14 DMEDXW9 Obesity 5B81 Patented [15]
Pyrazole derivative 15 DMJCX8M Obesity 5B81 Patented [15]
Pyrazole derivative 16 DM5A8F3 Obesity 5B81 Patented [15]
Pyrazole derivative 17 DM7F9V4 Obesity 5B81 Patented [15]
Pyrazole derivative 18 DMVZ8KD Obesity 5B81 Patented [15]
Pyrazole derivative 19 DMM7OR3 Obesity 5B81 Patented [15]
Pyrazole derivative 2 DMIS97T Obesity 5B81 Patented [15]
Pyrazole derivative 20 DM2HO1S Obesity 5B81 Patented [15]
Pyrazole derivative 21 DMUPNHA Obesity 5B81 Patented [15]
Pyrazole derivative 22 DMCS08K Obesity 5B81 Patented [15]
Pyrazole derivative 23 DMH2LFS Obesity 5B81 Patented [15]
Pyrazole derivative 24 DMVX2D0 Obesity 5B81 Patented [15]
Pyrazole derivative 25 DMM2RYG Obesity 5B81 Patented [15]
Pyrazole derivative 26 DMX92ZK Obesity 5B81 Patented [15]
Pyrazole derivative 27 DMDB5FH Obesity 5B81 Patented [15]
Pyrazole derivative 28 DMYEFW1 Obesity 5B81 Patented [15]
Pyrazole derivative 29 DM7DTYS Obesity 5B81 Patented [15]
Pyrazole derivative 3 DMX2NQW Obesity 5B81 Patented [15]
Pyrazole derivative 30 DMT1DJP Obesity 5B81 Patented [15]
Pyrazole derivative 31 DMDTQCG Obesity 5B81 Patented [15]
Pyrazole derivative 32 DMU59IJ Obesity 5B81 Patented [15]
Pyrazole derivative 33 DMUNLK8 Obesity 5B81 Patented [15]
Pyrazole derivative 34 DMRH2EJ Obesity 5B81 Patented [15]
Pyrazole derivative 35 DM6KROX Obesity 5B81 Patented [15]
Pyrazole derivative 36 DMSDVI1 Obesity 5B81 Patented [15]
Pyrazole derivative 37 DMZJ5FN Obesity 5B81 Patented [15]
Pyrazole derivative 38 DMPVDSC Obesity 5B81 Patented [15]
Pyrazole derivative 39 DMMGWKE Obesity 5B81 Patented [15]
Pyrazole derivative 4 DM2DK1E Obesity 5B81 Patented [15]
Pyrazole derivative 40 DM7CMV6 Obesity 5B81 Patented [15]
Pyrazole derivative 5 DMDGSKH Obesity 5B81 Patented [15]
Pyrazole derivative 53 DMMIOZ5 Obesity 5B81 Patented [15]
Pyrazole derivative 54 DM9PNTF Obesity 5B81 Patented [15]
Pyrazole derivative 57 DMZ3J78 Obesity 5B81 Patented [15]
Pyrazole derivative 58 DMZIOW0 Obesity 5B81 Patented [15]
Pyrazole derivative 59 DMXZC8K Obesity 5B81 Patented [15]
Pyrazole derivative 6 DMIDN6T Obesity 5B81 Patented [15]
Pyrazole derivative 60 DMQ08BM Obesity 5B81 Patented [15]
Pyrazole derivative 7 DMYKU0T Obesity 5B81 Patented [15]
Pyrazole derivative 8 DMMRTAL Obesity 5B81 Patented [15]
Pyrazoline derivative 1 DMGS2ET Obesity 5B81 Patented [15]
Pyrazoline derivative 10 DMCZORA Obesity 5B81 Patented [15]
Pyrazoline derivative 11 DMAB3YG Obesity 5B81 Patented [15]
Pyrazoline derivative 2 DMOA8E4 Obesity 5B81 Patented [15]
Pyrazoline derivative 3 DMGH0LQ Obesity 5B81 Patented [15]
Pyrazoline derivative 4 DMRT7I8 Obesity 5B81 Patented [15]
Pyrazoline derivative 5 DMEGS9U Obesity 5B81 Patented [15]
Pyrazolo[1,5-a]pyrimidine derivative 1 DM0FPMV Obesity 5B81 Patented [15]
Pyrazolo[1,5-a]pyrimidine derivative 10 DM07GEK Obesity 5B81 Patented [15]
Pyrazolo[1,5-a]pyrimidine derivative 11 DM0O4WR Obesity 5B81 Patented [15]
Pyrazolo[1,5-a]pyrimidine derivative 12 DMMLDUI Obesity 5B81 Patented [15]
Pyrazolo[1,5-a]pyrimidine derivative 13 DMR5O7T Obesity 5B81 Patented [15]
Pyrazolo[1,5-a]pyrimidine derivative 2 DMO3MJ7 Obesity 5B81 Patented [15]
Pyrazolo[1,5-a]pyrimidine derivative 3 DMHTV47 Obesity 5B81 Patented [15]
Pyrazolo[1,5-a]pyrimidine derivative 4 DMCAVF0 Obesity 5B81 Patented [15]
Pyrazolo[1,5-a]pyrimidine derivative 5 DM3UBG2 Obesity 5B81 Patented [15]
Pyrazolo[1,5-a]pyrimidine derivative 6 DM5E1KS Obesity 5B81 Patented [15]
Pyrazolo[1,5-a]pyrimidine derivative 7 DMFUSPR Obesity 5B81 Patented [15]
Pyrazolo[1,5-a]pyrimidine derivative 8 DMTQNYZ Obesity 5B81 Patented [15]
Pyrazolo[1,5-a]pyrimidine derivative 9 DMXAW2S Obesity 5B81 Patented [15]
Pyridotriazolopyrimidine derivative 1 DM71UYI Obesity 5B81 Patented [15]
Pyridotriazolopyrimidine derivative 2 DM0VOY9 Obesity 5B81 Patented [15]
Pyridotriazolopyrimidine derivative 3 DMYVCTD Obesity 5B81 Patented [15]
Pyrido[2,3-d]pyrimidine derivative 1 DMHZLSO Obesity 5B81 Patented [15]
Pyrido[2,3-d]pyrimidine derivative 2 DMSM53I Obesity 5B81 Patented [15]
Pyrrole derivative 1 DM0RC1Z Obesity 5B81 Patented [15]
Pyrrole derivative 2 DMMNKFX Obesity 5B81 Patented [15]
Pyrrole derivative 3 DMFV64B Obesity 5B81 Patented [15]
Pyrrole derivative 4 DMQDL43 Obesity 5B81 Patented [15]
Pyrrole derivative 5 DMJUMC6 Obesity 5B81 Patented [15]
Pyrrole derivative 6 DM875RE Obesity 5B81 Patented [15]
Sulfonamide derivative 1 DMTX21L Obesity 5B81 Patented [15]
Sulfonylated piperazine derivative 1 DMCO8JD Obesity 5B81 Patented [15]
Sulfonylated piperazine derivative 2 DMZYPV3 Obesity 5B81 Patented [15]
Sulfonylated piperazine derivative 3 DMOJAZ9 Obesity 5B81 Patented [15]
Sulfonylated piperazine derivative 4 DMZW2XP Obesity 5B81 Patented [15]
Sulfonylated piperazine derivative 5 DM65NBS Obesity 5B81 Patented [15]
Tetra-hydro-1H-1,2,6-triazaazulene derivative 1 DMUXNKG Obesity 5B81 Patented [15]
Tetra-hydro-1H-1,2,6-triazaazulene derivative 2 DMVTZ6S Obesity 5B81 Patented [15]
Tricyclic phytocannabinoid derivative 1 DM94NZF Neuropathic pain 8E43.0 Patented [16]
Tricyclic phytocannabinoid derivative 2 DM7YVQL Neuropathic pain 8E43.0 Patented [16]
------------------------------------------------------------------------------------
⏷ Show the Full List of 162 Patented Agent(s)
13 Discontinued Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
CP-945598 DMOU173 Obesity 5B81 Discontinued in Phase 3 [17]
Taranabant DM5G9W0 Obesity 5B81 Discontinued in Phase 3 [18]
AVE1625 DMXNK0J Psychotic disorder 6A20-6A25 Discontinued in Phase 2 [19]
AZD2207 DM1TDWI Diabetic complication 5A2Y Discontinued in Phase 2 [7]
KDS-2000 DMX9M53 Postherpetic neuralgia 1E91.5 Discontinued in Phase 2 [20]
KN-38-7271 DMN4BIA Ischemia 8B10-8B11 Discontinued in Phase 2 [21]
SLV319 DM0GKHX Obesity 5B81 Discontinued in Phase 2 [22]
AZD1175 DM65MUI Diabetic complication 5A2Y Discontinued in Phase 1 [7]
AZD1704 DMVE4P3 Pain MG30-MG3Z Discontinued in Phase 1 [7]
CBD cannabis derivative DM3G4JD Schizophrenia 6A20 Discontinued in Phase 1 [23]
PF-514273 DMS7M0U Obesity 5B81 Discontinued in Phase 1 [24]
TAK-937 DM13YN0 Cerebrovascular ischaemia 8B1Z Discontinued in Phase 1 [25]
WIN-55212-2 DMACBIW N. A. N. A. Terminated [27]
------------------------------------------------------------------------------------
⏷ Show the Full List of 13 Discontinued Drug(s)
2 Preclinical Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
CB1 antagonist, Bayer DM53JW0 Obesity 5B81 Preclinical [5]
JD-5037 DMTGI64 Diabetic complication 5A2Y Preclinical [26]
------------------------------------------------------------------------------------
182 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
(1R,2R)-N-Arachidonoylcyclopropanolamide DMYLPV1 Discovery agent N.A. Investigative [28]
(1R,2S)-N-Arachidonoylcyclopropanolamide DM39AFU Discovery agent N.A. Investigative [28]
(1R,2S)-N-Oleoylcyclopropanolamide DMITW5P Discovery agent N.A. Investigative [28]
(1S,2S)-N-Arachidonoylcyclopropanolamide DMKA0ON Discovery agent N.A. Investigative [28]
(1S,2S)-N-Oleoylcyclopropanolamide DMIV2OY Discovery agent N.A. Investigative [28]
(2R)-N-(6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDIN-4-YL)-2-HYDROXYPROPANAMIDE (ENANTIOMERIC MIX) DMXPQU6 Discovery agent N.A. Investigative [29]
(2R)-N-(7'-(2-CHLOROPHENYL)-6'-(4-CHLOROPHENYL)-3',4'-DIHYDROSPIRO[CYCLOHEXANE-1,2'-PYRANO[2,3-B]PYRIDINE]-4'-YL)-2-HYDROXYPROPANAMIDE (ENANTIOMERIC MIX) DMX0YIV Discovery agent N.A. Investigative [29]
(2S)-N-(7'-(2-CHLOROPHENYL)-6'-(4-CHLOROPHENYL)-3',4'-DIHYDROSPIRO[CYCLOHEXANE-1,2'-PYRANO[2,3-B]PYRIDINE]-4'-YL)-2-HYDROXYPROPANAMIDE (ENANTIOMERIC MIX) DMRCMIT Discovery agent N.A. Investigative [29]
(4-benzhydrylpiperazin-1-yl)(cyclohexyl)methanone DM1XY7C Discovery agent N.A. Investigative [30]
(E)-N-(3,5-dimethoxyphenethyl)undec-2-enamide DM9WHD2 Discovery agent N.A. Investigative [31]
(E)-N-(4-methoxyphenethyl)undec-2-enamide DML6PJD Discovery agent N.A. Investigative [31]
(E)-N-(4-methoxyphenyl)undec-2-enamide DM1PCEM Discovery agent N.A. Investigative [31]
1,3,5-triphenylimidazolidine-2,4-dione DM7U6S0 Discovery agent N.A. Investigative [32]
1,3,5-tris(4-chlorophenyl)imidazolidine-2,4-dione DMDNM05 Discovery agent N.A. Investigative [32]
1,4-dihydroindeno[1,2-c]-pyrazole DMMGP9X Discovery agent N.A. Investigative [33]
1,5-bis(4-chlorophenyl)-1H-1,2,3-triazole DMF0RXK Discovery agent N.A. Investigative [34]
1-(2-morpholinoethyl)-1H-indol-3-yl acetate DMZF0D3 Discovery agent N.A. Investigative [35]
1-(4-CHLOROPHENYL)-2-(2,4-DICHLOROPHENYL)-5-(METHYLSULFINYL)-N-(PIPERIDIN-1-YL)-1H-IMIDAZOLE-4-CARBOXAMIDE (ENANTIOMERIC MIX) DMV8C7I Discovery agent N.A. Investigative [36]
1-(bis(4-bromophenyl)methyl)-3-phenylurea DMYO8D3 Discovery agent N.A. Investigative [37]
1-(bis(4-chlorophenyl)methyl)-3-phenylurea DMTVNO3 Discovery agent N.A. Investigative [37]
1-[bis(4-bromophenyl)methyl]-3-phenylthiourea DM13D4E Discovery agent N.A. Investigative [37]
1-[bis(4-chlorophenyl)methyl]-3-(4-chlorophenyl)- DMN2LHM Discovery agent N.A. Investigative [37]
1-[bis(4-chlorophenyl)methyl]-3-phenylthiourea DMFMR2N Discovery agent N.A. Investigative [37]
1-[bis(4-iodophenyl)methyl]-3-(4-bromophenyl)urea DMJT7VI Discovery agent N.A. Investigative [37]
2'-amino-4-(1,1-dimethyl-heptyl)-biphenyl-2-ol DMTP3LD Discovery agent N.A. Investigative [38]
2-Benzylbenzo[f]chromen-3-one DMM48L6 Discovery agent N.A. Investigative [27]
3'-amino-4-(1,1-dimethyl-heptyl)-biphenyl-2-ol DMJ7Y3H Discovery agent N.A. Investigative [38]
3,4-diarylpyrazoline derivative DM8R03D Discovery agent N.A. Investigative [39]
3-Benzyl-5-isopropyl-8-methylchromen-2-one DMKZDYP Discovery agent N.A. Investigative [27]
3-Benzyl-5-methoxy-7-methylchromen-2-one DMF04YH Discovery agent N.A. Investigative [27]
3-Benzyl-5-methoxychromen-2-one DMSIAMN Discovery agent N.A. Investigative [27]
4'-amino-4-(1,1-dimethyl-heptyl)-biphenyl-2-ol DMQ6EBR Discovery agent N.A. Investigative [38]
4-(1,1-dimethyl-heptyl)-2'-methoxy-biphenyl-2-ol DMV4QRF Discovery agent N.A. Investigative [38]
4-(1,1-dimethyl-heptyl)-3'-methoxy-biphenyl-2-ol DM5BN41 Discovery agent N.A. Investigative [38]
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one DMM9X0G Discovery agent N.A. Investigative [40]
4-benzhydryl-N-butylpiperazine-1-carboxamide DMVSNPB Discovery agent N.A. Investigative [30]
4-benzhydryl-N-cyclohexylpiperazine-1-carboxamide DMASO86 Discovery agent N.A. Investigative [30]
4-cyanophenyl ethyl dodecylphosphonate DMEP80Q Discovery agent N.A. Investigative [41]
5-(1,1-dimethyl-heptyl)-2-pyridin-3-yl-phenol DMS31H9 Discovery agent N.A. Investigative [38]
5-Biphenyl-4-ylmethyl-2-isobutyl-2H-tetrazole DMCPIK5 Discovery agent N.A. Investigative [42]
5-Methoxy-3-(2-methoxybenzyl)-2H-chromen-2-one DMW9D30 Discovery agent N.A. Investigative [27]
6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDINE-4-CARBOXAMIDE (ENANTIOMERIC MIX) DM0C1FX Discovery agent N.A. Investigative [29]
6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-N-((R)-1-HYDROXYETHYL)-1,2,2-TRIMETHYL-1,2,3,4-TETRAHYDRO-1,8-NAPHTHYRIDINE-4-CARBOXAMIDE (ENANTIOMERIC MIX) DM1N46J Discovery agent N.A. Investigative [29]
6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-N-(1-HYDROXY-2-METHYLPROPAN-2-YL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDINE-4-CARBOXAMIDE (ENANTIOMERIC MIX) DM5H4KE Discovery agent N.A. Investigative [29]
6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-N-(HYDROXYMETHYL)-1,2,2-TRIMETHYL-1,2,3,4-TETRAHYDRO-1,8-NAPHTHYRIDINE-4-CARBOXAMIDE (ENANTIOMERIC MIX) DMEJ83H Ovarian cancer 2C73 Investigative [29]
A-796260 DMHFPRJ Pain MG30-MG3Z Investigative [43]
ACEA DMWX3HT Discovery agent N.A. Investigative [44]
AM-1241 DMFVGXW Discovery agent N.A. Investigative [43]
AM-1710 DMO7QUP Discovery agent N.A. Investigative [45]
AM-1714 DMW9ERM Discovery agent N.A. Investigative [45]
AM-1715 DMKJQZ4 Discovery agent N.A. Investigative [45]
AM-281 DMOKN27 Discovery agent N.A. Investigative [27]
AM-404 DMBK9PS Discovery agent N.A. Investigative [46]
AM-411 DMU3Y4J Discovery agent N.A. Investigative [47]
AM-4768 DMETXA8 Discovery agent N.A. Investigative [45]
AM-630 DM7R605 Discovery agent N.A. Investigative [48]
AM251 DMTAWHL Discovery agent N.A. Investigative [49]
Anandamide DMCKH3P Discovery agent N.A. Investigative [50]
arachidonylcyclopropylamide DMZM5KE Discovery agent N.A. Investigative [44]
AZ-599 DM1XE4F Pain MG30-MG3Z Investigative [51]
BMS-812204 DM1HBF5 Obesity 5B81 Investigative [51]
cannabinol DMM6A7P Discovery agent N.A. Investigative [52]
Chlorphrifos oxon DMGBT68 Discovery agent N.A. Investigative [41]
Cis-N-oleoylcyclopropanolamide DM7TU1I N. A. N. A. Investigative [28]
CP-4497 DMTHVCA Discovery agent N.A. Investigative [53]
CXB-029 DMAPRDE Central nervous system disease 8A04-8D87 Investigative [51]
DELTA 8-TETRAHYDROCANNOBINOL DM5ARHI Discovery agent N.A. Investigative [54]
Dibenzothiazepines DMEDKA3 Drug abuse 6C4G.1Z Investigative [51]
Dodecane-1-sulfonyl fluoride DME9CGK Discovery agent N.A. Investigative [41]
HU210 DM48F3D Discovery agent N.A. Investigative [55]
Isopropyl 4-nitrophenyl dodecylphosphonate DM2VJF4 Discovery agent N.A. Investigative [41]
Isopropyl dodecylfluorophosphonate DML54EA Discovery agent N.A. Investigative [56]
JWH-120 DM7JQDS Discovery agent N.A. Investigative [57]
JWH-133 DM1DEYU Discovery agent N.A. Investigative [58]
JWH-145 DMZQ31O Discovery agent N.A. Investigative [59]
JWH-146 DMU7E6A Discovery agent N.A. Investigative [59]
JWH-147 DMEX9GV Discovery agent N.A. Investigative [59]
JWH-150 DM86OZD Discovery agent N.A. Investigative [59]
JWH-156 DMWGSQO Discovery agent N.A. Investigative [59]
JWH-229 DMMKYGP Discovery agent N.A. Investigative [57]
JWH-243 DMGD73A Discovery agent N.A. Investigative [59]
JWH-244 DMETAOU Discovery agent N.A. Investigative [59]
JWH-245 DMC5RZ9 Discovery agent N.A. Investigative [59]
JWH-246 DMGTEYB Discovery agent N.A. Investigative [59]
JWH-268 DM07XBG Discovery agent N.A. Investigative [57]
JWH-292 DM5FAUY Discovery agent N.A. Investigative [59]
JWH-293 DMCK1XR Discovery agent N.A. Investigative [59]
JWH-297 DM4A761 Discovery agent N.A. Investigative [60]
JWH-307 DM23RUZ Discovery agent N.A. Investigative [59]
JWH-308 DMV5ASE Discovery agent N.A. Investigative [59]
JWH-309 DMTV1B9 Discovery agent N.A. Investigative [59]
JWH-324 DMJ2EI9 Discovery agent N.A. Investigative [53]
JWH-325 DMHNTZ8 Discovery agent N.A. Investigative [60]
JWH-337 DMK3DUZ Discovery agent N.A. Investigative [60]
JWH-342 DMTSZFB Discovery agent N.A. Investigative [60]
JWH-344 DM6VZ3T Discovery agent N.A. Investigative [60]
JWH-345 DML53SK Discovery agent N.A. Investigative [60]
JWH-346 DMHNILP Discovery agent N.A. Investigative [59]
JWH-347 DMK2NQ1 Discovery agent N.A. Investigative [59]
JWH-348 DMQIVPK Discovery agent N.A. Investigative [59]
JWH-363 DMFLB1Z Discovery agent N.A. Investigative [59]
JWH-364 DMP6C4D Discovery agent N.A. Investigative [59]
JWH-365 DM2ZXBR Discovery agent N.A. Investigative [59]
JWH-366 DMSNLFJ Discovery agent N.A. Investigative [59]
JWH-367 DM7ZF2K Discovery agent N.A. Investigative [59]
JWH-368 DMK0FNX Discovery agent N.A. Investigative [59]
JWH-369 DMPDTWY Discovery agent N.A. Investigative [59]
JWH-370 DM6IG7P Discovery agent N.A. Investigative [59]
JWH-371 DME0URP Discovery agent N.A. Investigative [59]
JWH-372 DM9D3GM Discovery agent N.A. Investigative [59]
JWH-373 DMWP84R Discovery agent N.A. Investigative [59]
JWH-385 DMU1HA7 Discovery agent N.A. Investigative [60]
JWH-392 DMMUBIF Discovery agent N.A. Investigative [60]
JWH-401 DMFL6B9 Discovery agent N.A. Investigative [60]
JWH-402 DM8TQIF Discovery agent N.A. Investigative [60]
JWH-403 DMRG1VI Discovery agent N.A. Investigative [60]
JWH-404 DM3KWER Discovery agent N.A. Investigative [60]
JWH-405 DM57TN3 Discovery agent N.A. Investigative [60]
JWH-406 DMNP7GD Discovery agent N.A. Investigative [60]
JWH-407 DMZQ0V9 Discovery agent N.A. Investigative [60]
JWH-440 DM89602 Discovery agent N.A. Investigative [53]
JWH-442 DMX6F1L Discovery agent N.A. Investigative [53]
KM-233 DMZSYKC Discovery agent N.A. Investigative [61]
KM-233-M DMK4IBO Discovery agent N.A. Investigative [61]
LY320135 DMK3Y5U Discovery agent N.A. Investigative [62]
Methanandamide DMZVF6M Discovery agent N.A. Investigative [63]
Methyl icosylphosphonofluoridate DM9O5S6 Discovery agent N.A. Investigative [41]
MK-5596 DMLWMZ4 Obesity 5B81 Investigative [51]
N-(1-adamantyl)-N'-propylsulfamide DM29QT4 Discovery agent N.A. Investigative [64]
N-(1H-indazol-5-yl)icosa-5,8,11,14-tetraenamide DM63YJV Discovery agent N.A. Investigative [65]
N-(2,4-dimethoxyphenethyl)docos-13-enamide DM3QWZU Discovery agent N.A. Investigative [31]
N-(2,4-dimethoxyphenethyl)oleamide DMRQSD2 Discovery agent N.A. Investigative [31]
N-(2-adamantyl)-N'-propylsulfamide DM6QZPH Discovery agent N.A. Investigative [64]
N-(2-chloroethyl)icosa-5,8,11,14-tetraenamide DMU5R2O Discovery agent N.A. Investigative [48]
N-(3,3-Diphenyl)propyl-2,2-diphenylacetamide DMAXLVQ Discovery agent N.A. Investigative [66]
N-(3,3-Diphenyl)propyl-2-phenylacetamide DMBX0K1 Discovery agent N.A. Investigative [66]
N-(3,5-dimethoxyphenethyl)docos-13-enamide DM95SJU Discovery agent N.A. Investigative [31]
N-(3,5-dimethoxyphenethyl)oleamide DM1C40H Discovery agent N.A. Investigative [31]
N-(3-Phenyl)propyl-2,2-diphenylacetamide DM9XH18 Discovery agent N.A. Investigative [66]
N-(3-Phenyl)propyl-2-(4-bromophenylacetamide) DMSNF7W Discovery agent N.A. Investigative [66]
N-(4-hydroxybenzyl)icosa-5,8,11,14-tetraenamide DM7O5WS Discovery agent N.A. Investigative [65]
N-(4-methoxybenzyl)oleamide DMHM3LC Discovery agent N.A. Investigative [31]
N-(4-methoxyphenethyl)oleamide DM5NOSM Discovery agent N.A. Investigative [31]
N-(4-methoxyphenyl)oleamide DMJVPK6 Discovery agent N.A. Investigative [31]
N-(4-morpholinophenyl)docos-13-enamide DMGRFYV Discovery agent N.A. Investigative [31]
N-(6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDIN-4-YL)-2-HYDROXYACETAMIDE (ENANTIOMERIC MIX) DMP7UZB Discovery agent N.A. Investigative [29]
N-(6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDIN-4-YL)-3-HYDROXY-2,2-DIMETHYLPROPANAMIDE (ENANTIOMERIC MIX) DMDPXUA Discovery agent N.A. Investigative [29]
N-(6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDIN-4-YL)-3-HYDROXYPROPANAMIDE (ENANTIOMERIC MIX) DMSX5DI Discovery agent N.A. Investigative [29]
N-(7'-(2-CHLOROPHENYL)-6'-(4-CHLOROPHENYL)-3',4'-DIHYDROSPIRO[CYCLOHEXANE-1,2'-PYRANO[2,3-B]PYRIDINE]-4'-YL)-2-HYDROXY-2-METHYLPROPANAMIDE (ENANTIOMERIC MIX) DM5F27T Discovery agent N.A. Investigative [29]
N-(7-(2-CHLOROPHENYL)-6-(4-CHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDIN-4-YL)-2-HYDROXYACETAMIDE (ENANTIOMERIC MIX) DMO3Y0B Discovery agent N.A. Investigative [29]
N-(cis-9-cis-12-octadecadienyl)sulfamide DM1TA5R Discovery agent N.A. Investigative [64]
N-arachidonoyl-N-(2-hydroxyethyl)hydroxylamine DMF9U2O Discovery agent N.A. Investigative [67]
N-arachidonoyl-O-(2-hydroxyethyl)hydroxylamine DM49HIO Discovery agent N.A. Investigative [67]
N-ethyl-5,6-dip-tolylpyrazine-2-carboxamide DM873WR Discovery agent N.A. Investigative [68]
N-isopentyl-5,6-dip-tolylpyrazine-2-carboxamide DMC8L4J Discovery agent N.A. Investigative [68]
N-isopropyl-5,6-dip-tolylpyrazine-2-carboxamide DMRPUCA Discovery agent N.A. Investigative [68]
N-methyl-5,6-dip-tolylpyrazine-2-carboxamide DMD621E Discovery agent N.A. Investigative [68]
N-octadecyl-N'-propylsulfamide DMKTE5V Discovery agent N.A. Investigative [64]
N-oleoylethanolamide DMJQ4L7 Discovery agent N.A. Investigative [28]
N-phenyl-5,6-dip-tolylpyrazine-2-carboxamide DM7XER1 Discovery agent N.A. Investigative [68]
N-[6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDINE-4-YL]-4,4,4-TRIFLUORO-3-HYDROXYBUTANAMIDE (DIASTEREOMERIC MIX) DMVY7RX Discovery agent N.A. Investigative [69]
NAPHTHYRIDINONE DM0OEGV Discovery agent N.A. Investigative [29]
O-1812 DMCXMQJ Discovery agent N.A. Investigative [70]
O-arachidonoyl-N-(2-hydroxyethyl)hydroxylamine DMWZXH6 Discovery agent N.A. Investigative [67]
Octane-1-sulfonyl fluoride DMDBI5S Discovery agent N.A. Investigative [41]
Org27569 DMRU3H0 Discovery agent N.A. Investigative [71]
PARAOXON DMN4ZKC Discovery agent N.A. Investigative [41]
PMID26161824C70 DMTO95J Discovery agent N.A. Investigative [15]
PRAVADOLINE DM3XRJT Discovery agent N.A. Investigative [72]
Rac-cis-N-arachidonoylcyclopropanolamide DMR8L6O Discovery agent N.A. Investigative [28]
Rac-trans-N-oleoylcyclopropanolamide DM9DA8O N. A. N. A. Investigative [28]
SCH-356036 DMOEB8M Discovery agent N.A. Investigative [73]
SEMIPLENAMIDE A DMW5SIQ Discovery agent N.A. Investigative [74]
SEMIPLENAMIDE B DMHWCFJ Discovery agent N.A. Investigative [74]
Semiplenamide G DM4RP0A Discovery agent N.A. Investigative [74]
VER-156084 DMFZMA2 Neuropathic pain 8E43.0 Investigative [75]
VER-156085 DMCRHOA Discovery agent N.A. Investigative [75]
[123I]AM251 DMCJQ0P Discovery agent N.A. Investigative [76]
[3H]CP55940 DMU7FC5 Discovery agent N.A. Investigative [77]
[3H]HU-243 DM8YUW6 Discovery agent N.A. Investigative [78]
[3H]WIN55212-2 DM0TRAZ Discovery agent N.A. Investigative [79]
{[(9Z)-octadec-9-en-1-yl]sulfamoyl}amine DMMB4US Discovery agent N.A. Investigative [64]
------------------------------------------------------------------------------------
⏷ Show the Full List of 182 Investigative Drug(s)

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTT
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Type 2 diabetes 5A11 Liver tissue 7.77E-01 8.39E-05 4.59E-04
Schizophrenia 6A20 Pre-frontal cortex 5.59E-02 -0.22 -0.45
Schizophrenia 6A20 Superior temporal cortex 7.68E-01 -0.06 -0.46
Ovarian cancer 2C82 Ovarian tissue 1.95E-01 -0.27 -0.6
------------------------------------------------------------------------------------

References

1 Emerging strategies for exploiting cannabinoid receptor agonists as medicines. Br J Pharmacol. 2009 Feb;156(3):397-411.
2 Novel 1',1'-chain substituted hexahydrocannabinols: 9-hydroxy-3-(1-hexyl-cyclobut-1-yl)-hexahydrocannabinol (AM2389) a highly potent cannabinoid r... J Med Chem. 2010 Oct 14;53(19):6996-7010.
3 Tetrahydrolipstatin analogues as modulators of endocannabinoid 2-arachidonoylglycerol metabolism. J Med Chem. 2008 Nov 13;51(21):6970-9.
4 Anti-obesity drugs. Expert Opin Pharmacother. 2008 Jun;9(8):1339-50.
5 Emerging drugs for obesity: linking novel biological mechanisms to pharmaceutical pipelines. Expert Opin Emerg Drugs. 2005 Aug;10(3):643-60.
6 Clinical pipeline report, company report or official report of Affimed Therapeutics.
7 Clinical pipeline report, company report or official report of AstraZeneca (2009).
8 Company report (Gwpharm)
9 Clinical pipeline report, company report or official report of Bird Rock Bio.
10 Surinabant, a selective cannabinoid receptor type 1 antagonist, inhibits 9-tetrahydrocannabinol-induced central nervous system and heart rate effects in humans.Br J Clin Pharmacol.2013 Jul;76(1):65-77.
11 ClinicalTrials.gov (NCT04880291) A First-In-Human, Phase 1, Randomized, Double-Blind, Placebo-Controlled Study to Evaluate the Safety, Tolerability, and Pharmacokinetics of GFB-024 as a Single Dose in Healthy Overweight and Obese Participants and as Multiple Doses in Participants With Type 2 Diabetes Mellitus. U.S.National Institutes of Health.
12 2011 Pipeline of 7TM Pharma.
13 Cannabinoid receptor antagonists: pharmacological opportunities, clinical experience, and translational prognosis. Expert Opin Emerg Drugs. 2009 Mar;14(1):43-65.
14 2011 Pipeline of Zydus Cadila Group.
15 A comprehensive patents review on cannabinoid 1 receptor antagonists as antiobesity agents. Expert Opin Ther Pat. 2015 Oct;25(10):1093-116.
16 Cannabinoid receptor 2 (CB2) agonists and antagonists: a patent update.Expert Opin Ther Pat. 2016 Jul;26(7):843-56.
17 Pfizer. Product Development Pipeline. March 31 2009.
18 Central side-effects of therapies based on CB1 cannabinoid receptor agonists and antagonists: focus on anxiety and depression. Best Pract Res Clin Endocrinol Metab. 2009 Feb;23(1):133-44.
19 Pharma & Vaccines. Product Development Pipeline. April 29 2009.
20 Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26.
21 BAY 38-7271: a novel highly selective and highly potent cannabinoid receptor agonist for the treatment of traumatic brain injury.CNS Drug Rev.2003 Winter;9(4):343-58.
22 JD-5006 and JD-5037: peripherally restricted (PR) cannabinoid-1 receptor blockers related to SLV-319 (Ibipinabant) as metabolic disorder therapeutics devoid of CNS liabilities. Bioorg Med Chem Lett. 2012 Oct 1;22(19):6173-80.
23 The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22.
24 Effects of the novel cannabinoid CB1 receptor antagonist PF 514273 on the acquisition and expression of ethanol conditioned place preference. Alcohol. 2014 Aug;48(5):427-31.
25 Cerebroprotective effects of TAK-937, a cannabinoid receptor agonist, on ischemic brain damage in middle cerebral artery occluded rats and non-human primates. Brain Res. 2012 Jan 9;1430:93-100.
26 2011 Pipeline of Jenrin Discovery.
27 Synthesis and pharmacological evaluation of coumarin derivatives as cannabinoid receptor antagonists and inverse agonists. Bioorg Med Chem. 2009 Apr 1;17(7):2842-51.
28 Conformationally constrained fatty acid ethanolamides as cannabinoid and vanilloid receptor probes. J Med Chem. 2009 May 14;52(9):3001-9.
29 Dihydro-pyrano[2,3-b]pyridines and tetrahydro-1,8-naphthyridines as CB1 receptor inverse agonists: synthesis, SAR and biological evaluation. Bioorg Med Chem Lett. 2010 Jun 15;20(12):3750-4.
30 Discovery of benzhydrylpiperazine derivatives as CB1 receptor inverse agonists via privileged structure-based approach. Eur J Med Chem. 2010 Mar;45(3):1133-9.
31 New metabolically stable fatty acid amide ligands of cannabinoid receptors: Synthesis and receptor affinity studies. Bioorg Med Chem Lett. 2006 Jan 1;16(1):138-41.
32 Synthesis and activity of 1,3,5-triphenylimidazolidine-2,4-diones and 1,3,5-triphenyl-2-thioxoimidazolidin-4-ones: characterization of new CB1 cann... J Med Chem. 2006 Feb 9;49(3):872-82.
33 Tricyclic pyrazoles. 3. Synthesis, biological evaluation, and molecular modeling of analogues of the cannabinoid antagonist 8-chloro-1-(2',4'-dichl... J Med Chem. 2005 Nov 17;48(23):7351-62.
34 Synthesis and CB1 cannabinoid receptor affinity of 4-alkoxycarbonyl-1,5-diaryl-1,2,3-triazoles. Bioorg Med Chem Lett. 2009 Feb 1;19(3):891-3.
35 Synthesis and cannabinoid activity of 1-substituted-indole-3-oxadiazole derivatives: novel agonists for the CB1 receptor. Eur J Med Chem. 2008 Mar;43(3):513-39.
36 Probing the cannabinoid CB1/CB2 receptor subtype selectivity limits of 1,2-diarylimidazole-4-carboxamides by fine-tuning their 5-substitution pattern. Bioorg Med Chem Lett. 2010 May 1;20(9):2770-5.
37 1-Benzhydryl-3-phenylurea and 1-benzhydryl-3-phenylthiourea derivatives: new templates among the CB1 cannabinoid receptor inverse agonists. J Med Chem. 2005 Nov 17;48(23):7486-90.
38 Biaryl cannabinoid mimetics--synthesis and structure-activity relationship. Bioorg Med Chem Lett. 2007 Jul 1;17(13):3652-6.
39 Novel 3,4-diarylpyrazolines as potent cannabinoid CB1 receptor antagonists with lower lipophilicity. Bioorg Med Chem Lett. 2005 Nov 1;15(21):4794-8.
40 Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97.
41 Monoacylglycerol lipase regulates 2-arachidonoylglycerol action and arachidonic acid levels. Bioorg Med Chem Lett. 2008 Nov 15;18(22):5875-8.
42 New tetrazole-based selective anandamide uptake inhibitors. Bioorg Med Chem Lett. 2008 May 1;18(9):2820-4.
43 Indol-3-ylcycloalkyl ketones: effects of N1 substituted indole side chain variations on CB(2) cannabinoid receptor activity. J Med Chem. 2010 Jan 14;53(1):295-315.
44 Synthesis and characterization of potent and selective agonists of the neuronal cannabinoid receptor (CB1). J Pharmacol Exp Ther. 1999 Jun;289(3):1427-33.
45 Cannabilactones: a novel class of CB2 selective agonists with peripheral analgesic activity. J Med Chem. 2007 Dec 27;50(26):6493-500.
46 Head group analogs of arachidonylethanolamide, the endogenous cannabinoid ligand. J Med Chem. 1996 Oct 25;39(22):4515-9.
47 Heteroadamantyl cannabinoids. J Med Chem. 2010 Aug 12;53(15):5656-66.
48 New 1,8-naphthyridine and quinoline derivatives as CB2 selective agonists. Bioorg Med Chem Lett. 2007 Dec 1;17(23):6505-10.
49 Anandamide is able to inhibit trigeminal neurons using an in vivo model of trigeminovascular-mediated nociception. J Pharmacol Exp Ther. 2004 Apr;309(1):56-63.
50 Opioid receptor and NO/cGMP pathway as a mechanism of peripheral antinociceptive action of the cannabinoid receptor agonist anandamide. Life Sci. 2009 Aug 26;85(9-10):351-6.
51 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 56).
52 Evaluation of binding in a transfected cell line expressing a peripheral cannabinoid receptor (CB2): identification of cannabinoid receptor subtype selective ligands. J Pharmacol Exp Ther. 1996 Sep;278(3):989-99.
53 Synthesis and pharmacology of 1-methoxy analogs of CP-47,497. Bioorg Med Chem. 2010 Aug 1;18(15):5475-82.
54 Bornyl- and isobornyl-Delta8-tetrahydrocannabinols: a novel class of cannabinergic ligands. J Med Chem. 2008 Oct 23;51(20):6393-9.
55 The endogenous cannabinoid system protects against colonic inflammation. J Clin Invest. 2004 Apr;113(8):1202-9.
56 Activation of the endocannabinoid system by organophosphorus nerve agents. Nat Chem Biol. 2008 Jun;4(6):373-8.
57 Discovery of novel CB2 receptor ligands by a pharmacophore-based virtual screening workflow. J Med Chem. 2009 Jan 22;52(2):369-78.
58 1-Bromo-3-(1',1'-dimethylalkyl)-1-deoxy-(8)-tetrahydrocannabinols: New selective ligands for the cannabinoid CB(2) receptor. Bioorg Med Chem. 2010 Nov 15;18(22):7809-15.
59 1-Alkyl-2-aryl-4-(1-naphthoyl)pyrroles: new high affinity ligands for the cannabinoid CB1 and CB2 receptors. Bioorg Med Chem Lett. 2006 Oct 15;16(20):5432-5.
60 Synthesis and pharmacology of 1-deoxy analogs of CP-47,497 and CP-55,940. Bioorg Med Chem. 2008 Jan 1;16(1):322-35.
61 Exploring the substituent effects on a novel series of C1'-dimethyl-aryl Delta8-tetrahydrocannabinol analogs. Bioorg Med Chem. 2008 Jul 1;16(13):6489-500.
62 LY320135, a novel cannabinoid CB1 receptor antagonist, unmasks coupling of the CB1 receptor to stimulation of cAMP accumulation. J Pharmacol Exp Ther. 1998 Jan;284(1):291-7.
63 Methanandamide attenuates cocaine-induced hyperthermia in rats by a cannabinoid CB1-dopamine D2 receptor mechanism. Brain Res. 2009 Mar 13;1260:7-14.
64 Synthesis and pharmacological evaluation of sulfamide-based analogues of anandamide. Eur J Med Chem. 2009 Dec;44(12):4889-95.
65 New analgesics synthetically derived from the paracetamol metabolite N-(4-hydroxyphenyl)-(5Z,8Z,11Z,14Z)-icosatetra-5,8,11,14-enamide. J Med Chem. 2008 Dec 25;51(24):7800-5.
66 Novel sterically hindered cannabinoid CB1 receptor ligands. Bioorg Med Chem. 2008 Aug 1;16(15):7510-5.
67 Oxyhomologues of anandamide and related endolipids: chemoselective synthesis and biological activity. J Med Chem. 2006 Apr 6;49(7):2333-8.
68 Discovery of pyrazine carboxamide CB1 antagonists: the introduction of a hydroxyl group improves the pharmaceutical properties and in vivo efficacy... Bioorg Med Chem Lett. 2007 Jul 15;17(14):3978-82.
69 Discovery of N-[(4R)-6-(4-chlorophenyl)-7-(2,4-dichlorophenyl)-2,2-dimethyl-3,4-dihydro-2H-pyrano[2,3-b]pyridin-4-yl]-5-methyl-1H-pyrazole-3-carbox... J Med Chem. 2010 May 27;53(10):4028-37.
70 Highly selective CB(1) cannabinoid receptor ligands and novel CB(1)/VR(1) vanilloid receptor "hybrid" ligands. Biochem Biophys Res Commun. 2001 Feb 23;281(2):444-51.
71 Indole-2-carboxamides as allosteric modulators of the cannabinoid CB receptor. J Med Chem. 2012 Jun 14;55(11):5627-31.
72 Morpholinoalkylindenes as antinociceptive agents: Novel cannabinoid receptor agonists, Bioorg. Med. Chem. Lett. 5(4):381-386 (1995).
73 Synthesis and SAR of novel imidazoles as potent and selective cannabinoid CB2 receptor antagonists with high binding efficiencies. Bioorg Med Chem Lett. 2010 Feb 1;20(3):1084-9.
74 Semiplenamides A-G, fatty acid amides from a Papua New Guinea collection of the marine cyanobacterium Lyngbya semiplena. J Nat Prod. 2003 Oct;66(10):1364-8.
75 Fatty acid amide hydrolase inhibitors. Surprising selectivity of chiral azetidine ureas. Bioorg Med Chem Lett. 2009 Aug 1;19(15):4241-4.
76 Binding of the non-classical cannabinoid CP 55,940, and the diarylpyrazole AM251 to rodent brain cannabinoid receptors. Life Sci. 1997;61(14):PL 191-7.
77 Structural features of the central cannabinoid CB1 receptor involved in the binding of the specific CB1 antagonist SR 141716A. J Biol Chem. 1996 Mar 22;271(12):6941-6.
78 A novel probe for the cannabinoid receptor. J Med Chem. 1992 May 29;35(11):2065-9.
79 Ligand binding and modulation of cyclic AMP levels depend on the chemical nature of residue 192 of the human cannabinoid receptor 1. J Neurochem. 1998 Jan;70(1):366-73.