Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT6R7JZ)

• DTT Name: Histone deacetylase 1 (HDAC1)
• Synonyms: RPD3L1; HD1
• Gene Name: HDAC1
• DTT Type: Successful target; [1]
• Related Disease:
  Multiple myeloma [ICD-11: 2A83]
  Mycosis fungoides [ICD-11: 2B01]
• BioChemical Class: Carbon-nitrogen hydrolase
• UniProt ID: HDAC1_HUMAN
• TTD ID: T68547
• EC Number: EC 3.5.1.98
• Sequence:
  MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
  AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
  AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
  DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
  FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
  GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
  KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEF
  SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
  LA
• Function: Gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Deacetylates SP proteins, SP1 and SP3, and regulates their function. Component of the BRG1-RB1-HDAC1 complex, which negatively regulates the CREST-mediated transcription in resting neurons. Upon calcium stimulation, HDAC1 is released from the complex and CREBBP is recruited, which facilitates transcriptional activation. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Deacetylates 'Lys-310' in RELA and thereby inhibits the transcriptional activity of NF-kappa-B. Deacetylates NR1D2 and abrogates the effect of KAT5-mediated relieving of NR1D2 transcription repression activity. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. Involved in CIART-mediated transcriptional repression of the circadian transcriptional activator: CLOCK-ARNTL/BMAL1 heterodimer. Required for the transcriptional repression of circadian target genes, such as PER1, mediated by the large PER complex or CRY1 through histone deacetylation. Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4).
• KEGG Pathway:
  Cell cycle (hsa04110)
  Notch signaling pathway (hsa04330)
  Thyroid hormone signaling pathway (hsa04919)
  Huntington's disease (hsa05016)
  Amphetamine addiction (hsa05031)
  Alcoholism (hsa05034)
  Epstein-Barr virus infection (hsa05169)
  Pathways in cancer (hsa05200)
  Transcriptional misregulation in cancer (hsa05202)
  Viral carcinogenesis (hsa05203)
  MicroRNAs in cancer (hsa05206)
  Chronic myeloid leukemia (hsa05220)
• Reactome Pathway:
  p75NTR negatively regulates cell cycle via SC1 (R-HSA-193670)
  Formation of the beta-catenin (R-HSA-201722)
  NOTCH1 Intracellular Domain Regulates Transcription (R-HSA-2122947)
  SMAD2/SMAD3 (R-HSA-2173796)
  Constitutive Signaling by NOTCH1 PEST Domain Mutants (R-HSA-2644606)
  Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants (R-HSA-2894862)
  HDACs deacetylate histones (R-HSA-3214815)
  Deactivation of the beta-catenin transactivating complex (R-HSA-3769402)
  NoRC negatively regulates rRNA expression (R-HSA-427413)
  RNA Polymerase I Transcription Initiation (R-HSA-73762)
  Factors involved in megakaryocyte development and platelet production (R-HSA-983231)
  G0 and Early G1 (R-HSA-1538133)

Molecular Interaction Atlas (MIA) of This DTT

4 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Panobinostat	DM58WKG	Multiple myeloma	2A83	Approved	[1], [2], [3], [4]
Romidepsin	DMT5GNL	Cutaneous T-cell lymphoma	2B01	Approved	[5]
Vorinostat	DMWMPD4	Cutaneous T-cell lymphoma	2B01	Approved	[1], [6], [4]
HBI-8000	DMDWYUN	Non-small-cell lung cancer	2C25.Y	Registered	[7]

12 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ITF2357	DMFZBNE	Duchenne dystrophy	8C70	Phase 3	[8], [9]
NVP-LAQ824	DM8JWNA	Mood disorder	6A60-6E23	Phase 3	[10]
SNDX-275	DMH7W9X	Breast cancer	2C60-2C65	Phase 3	[9]
MGCD-0103	DM726HX	Non-small-cell lung cancer	2C25.Y	Phase 2	[1], [3], [4]
Phenylbutyrate	DMBHPDW	Urea cycle disorder	5C50.A	Phase 2	[11]
Resminostat	DMNE1FR	Hepatocellular carcinoma	2C12.02	Phase 2	[12]
SB-623	DM4NY58	Cerebrovascular ischaemia	8B1Z	Phase 2	[3]
Sodium butyrate	DMKNIVG	Acute myeloid leukaemia	2A60	Phase 2	[4], [13]
CHR-3996	DMIXPNG	Lymphoma	2A80-2A86	Phase 1/2	[14]
OBP-801	DMPLV9G	Solid tumour/cancer	2A00-2F9Z	Phase 1	[15]
RG-2833	DM7B650	Friedreich's ataxia	8A03.10	Phase 1	[7]
SB-639	DMSZIP5	Solid tumour/cancer	2A00-2F9Z	Phase 1	[3]

76 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Diaryl amine derivative 2	DMRBYAV	N. A.	N. A.	Patented	[16]
Diaryl amine derivative 3	DMLBN1T	N. A.	N. A.	Patented	[16]
Isosteric imidazolyl pyrimidine derivative 1	DMP2QDM	N. A.	N. A.	Patented	[17]
PMID28092474-Compound-32a	DMGZ61E	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-32b	DMT2B5A	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-32c	DMGA3XL	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-32d	DMW21U4	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-32e	DM8NHQS	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-32f	DMEIZ6Y	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-32g	DMTKLEP	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-32h	DME1WHT	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-32i	DMN3ZEF	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-32j	DMSGWTX	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-32k	DMHSJ65	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-32l	DMSP5IA	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-32m	DMADMWB	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-32n	DMJO3RW	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-32o	DMV9BQN	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-32p	DM4ZO21	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-32q	DMEASZY	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-32r	DMLTKMS	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-32s	DMS103B	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-32t	DM2JF0T	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-32u	DM805ZN	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-32v	DMHV3ES	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-32x	DML79XQ	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-32y	DMLR03U	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-32z	DMEPWGH	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-33a	DM7GH4Y	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-33b	DMIJQZV	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-33c	DM51JP6	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-33d	DMW38MK	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-33e	DMGTSXL	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-33f	DMA360M	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-33g	DM18DY6	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-33h	DM1DN6V	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-33i	DM16E95	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-33j	DMNTRIZ	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-33k	DMF2ZNT	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-33l	DMPJSB2	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-33m	DMXSPT9	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-33o	DM6DJZ7	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-33p	DMI8ZBK	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-34a	DMXQE7C	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-34b	DM6X2CO	N. A.	N. A.	Patented	[16]
PMID28092474-Compound-34c	DMMI7DY	N. A.	N. A.	Patented	[16]
PMID29671355-Compound-11	DMNKABH	N. A.	N. A.	Patented	[18]
PMID29671355-Compound-13	DMALXYR	N. A.	N. A.	Patented	[18]
PMID29671355-Compound-18	DMUY53P	N. A.	N. A.	Patented	[18]
PMID29671355-Compound-19	DM9LMNB	N. A.	N. A.	Patented	[18]
PMID29671355-Compound-21	DMPJN0M	N. A.	N. A.	Patented	[18]
PMID29671355-Compound-22	DMRGV83	N. A.	N. A.	Patented	[18]
PMID29671355-Compound-23	DMUBOEX	N. A.	N. A.	Patented	[18]
PMID29671355-Compound-24	DMCIGJ1	N. A.	N. A.	Patented	[18]
PMID29671355-Compound-25	DMPV0KZ	N. A.	N. A.	Patented	[18]
PMID29671355-Compound-26	DM5K6MG	N. A.	N. A.	Patented	[18]
PMID29671355-Compound-27	DMP7S9E	N. A.	N. A.	Patented	[18]
PMID29671355-Compound-28	DMLXSHW	N. A.	N. A.	Patented	[18]
PMID29671355-Compound-31	DM3H78D	N. A.	N. A.	Patented	[18]
PMID29671355-Compound-38a	DMYATB5	N. A.	N. A.	Patented	[18]
PMID29671355-Compound-38b	DMYXE4J	N. A.	N. A.	Patented	[18]
PMID29671355-Compound-39	DM6EJ93	N. A.	N. A.	Patented	[18]
PMID29671355-Compound-42	DMXY103	N. A.	N. A.	Patented	[18]
PMID29671355-Compound-43	DMVPMWJ	N. A.	N. A.	Patented	[18]
PMID29671355-Compound-44	DM80A3V	N. A.	N. A.	Patented	[18]
PMID29671355-Compound-55	DMJV1SY	N. A.	N. A.	Patented	[18]
PMID29671355-Compound-56	DM0VBMI	N. A.	N. A.	Patented	[18]
PMID29671355-Compound-57	DM57N3Y	N. A.	N. A.	Patented	[18]
PMID29671355-Compound-59	DM2F0CQ	N. A.	N. A.	Patented	[18]
PMID29671355-Compound-61	DMXH1G3	N. A.	N. A.	Patented	[18]
PMID29671355-Compound-62	DMWRS34	N. A.	N. A.	Patented	[18]
PMID29671355-Compound-65a	DMY3Q58	N. A.	N. A.	Patented	[18]
PMID29671355-Compound-67	DM1RPL4	N. A.	N. A.	Patented	[18]
PMID29671355-Compound-73	DMCNF36	N. A.	N. A.	Patented	[18]
PMID29671355-Compound-8	DM7YQJK	N. A.	N. A.	Patented	[18]
PMID29671355-Compound-9	DMXL96M	N. A.	N. A.	Patented	[18]

4 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
AN-9	DMGL0Q2	Melanoma	2C30	Discontinued in Phase 2	[4]
Tacedinaline	DM1Z74X	Solid tumour/cancer	2A00-2F9Z	Discontinued in Phase 2	[3], [4]
Pyroxamide	DM4LNBQ	Solid tumour/cancer	2A00-2F9Z	Discontinued in Phase 1	[3], [4]
Oxamflatin	DM1TG3C	Solid tumour/cancer	2A00-2F9Z	Terminated	[3], [4]

8 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
4SC-202	DMXFC3W	Solid tumour/cancer	2A00-2F9Z	Preclinical	[12]
Chlamydocin	DM89DQP	Solid tumour/cancer	2A00-2F9Z	Preclinical	[3]
Depudecin	DMD0T1U	Solid tumour/cancer	2A00-2F9Z	Preclinical	[3], [4]
HC-Toxin	DMPLZ7E	Solid tumour/cancer	2A00-2F9Z	Preclinical	[3]
M-carboxycinnamic acid bishydroxamide	DMHJLPS	Solid tumour/cancer	2A00-2F9Z	Preclinical	[3], [4]
Scriptaid	DM9JZ21	Solid tumour/cancer	2A00-2F9Z	Preclinical	[3], [11], [4]
SK-7041	DM7DNOG	Solid tumour/cancer	2A00-2F9Z	Preclinical	[3], [4]
SK-7068	DMCI371	Solid tumour/cancer	2A00-2F9Z	Preclinical	[3], [4]

146 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(E)-8-Biphenyl-4-yl-1-oxazol-2-yl-oct-7-en-1-one	DM5LSY9	Discovery agent	N.A.	Investigative	[19]
1,1,1-Trifluoro-8-(4-phenoxy-phenoxy)-octan-2-one	DM6GI4Z	Discovery agent	N.A.	Investigative	[20]
1,1,1-Trifluoro-8-phenoxy-octan-2-one	DM41R2O	Discovery agent	N.A.	Investigative	[20]
2-(methylsulfonylthio)ethyl 2-propylpentanoate	DMM52D3	Discovery agent	N.A.	Investigative	[21]
4-Benzenesulfonylamino-N-hydroxy-benzamide	DMM6UPD	Discovery agent	N.A.	Investigative	[22]
4-Benzoylamino-N-hydroxy-benzamide	DMYBPFS	Discovery agent	N.A.	Investigative	[23]
4-Butyrylamino-N-hydroxy-benzamide	DMRY6B4	Discovery agent	N.A.	Investigative	[24]
4-Chloro-N-(5-hydroxycarbamoyl-pentyl)-benzamide	DM5AVG3	Discovery agent	N.A.	Investigative	[25]
4-Dimethylamino-N-(6-mercapto-hexyl)-benzamide	DM0M8G5	Discovery agent	N.A.	Investigative	[26]
4-Hydroxy-N-(5-hydroxycarbamoyl-pentyl)-benzamide	DMULOHZ	Discovery agent	N.A.	Investigative	[27]
4-Phenylbutyrohydroxamic acid	DMCZKN7	Discovery agent	N.A.	Investigative	[28]
4-tert-butyl-N-hydroxybenzamide	DMUWTPX	Discovery agent	N.A.	Investigative	[29]
5-(4-Chloro-phenyl)-pentanoic acid hydroxyamide	DM6CRVS	Discovery agent	N.A.	Investigative	[30]
5-(4-hydroxyphenyl)-3H-1,2-dithiole-3-thione	DM7KQXL	Discovery agent	N.A.	Investigative	[21]
5-Mercapto-pentanoic acid phenylamide	DMET3OJ	Discovery agent	N.A.	Investigative	[26]
6-(2-Bromo-acetylamino)-hexanoic acid phenylamide	DM9LKXD	Discovery agent	N.A.	Investigative	[26]
6-(3-Benzoyl-ureido)-hexanoic acid hydroxyamide	DMQZTS3	Discovery agent	N.A.	Investigative	[31]
6-(9H-carbazol-9-yl)-N-hydroxyhexanamide	DMVMDJ3	Discovery agent	N.A.	Investigative	[32]
6-benzenesulfinylhexanoic acid hydroxamide	DM2I95Z	Discovery agent	N.A.	Investigative	[33]
6-benzenesulfonylhexanoic acid hydroxamide	DMY9IK8	Discovery agent	N.A.	Investigative	[33]
6-Mercapto-hexanoic acid phenylamide	DMD2FW9	Discovery agent	N.A.	Investigative	[26]
6-Phenoxy-hexane-1-thiol	DMVYIN2	Discovery agent	N.A.	Investigative	[26]
6-phenylsulfanylhexanoic acid hydroxamide	DM3OLM6	Discovery agent	N.A.	Investigative	[33]
7-(1H-indol-5-yloxy)-N-hydroxyheptanamide	DMOZV9W	Discovery agent	N.A.	Investigative	[34]
7-(3-Benzoyl-ureido)-heptanoic acid hydroxyamide	DMCFV0X	Discovery agent	N.A.	Investigative	[31]
7-(4-(dimethylamino)phenoxy)-N-hydroxyheptanamide	DM2TNCK	Discovery agent	N.A.	Investigative	[34]
7-(Biphenyl-3-yloxy)-1-oxazol-2-yl-heptan-1-one	DMLCGSY	Discovery agent	N.A.	Investigative	[19]
7-(Biphenyl-4-yloxy)-1,1,1-trifluoro-heptan-2-one	DM28GZ7	Discovery agent	N.A.	Investigative	[20]
7-(Biphenyl-4-yloxy)-1-oxazol-2-yl-heptan-1-one	DMY027P	Discovery agent	N.A.	Investigative	[19]
7-(Biphenyl-4-yloxy)-heptanoic acid hydroxyamide	DMO4YLA	Discovery agent	N.A.	Investigative	[35]
7-(Naphthalen-2-yloxy)-1-oxazol-2-yl-heptan-1-one	DM4VQN8	Discovery agent	N.A.	Investigative	[19]
7-Biphenyl-4-yl-heptanoic acid hydroxyamide	DMV54MT	Discovery agent	N.A.	Investigative	[36]
7-Mercapto-heptanoic acid benzothiazol-2-ylamide	DMPYTHV	Discovery agent	N.A.	Investigative	[26]
7-Mercapto-heptanoic acid biphenyl-3-ylamide	DMEQKPO	Discovery agent	N.A.	Investigative	[26]
7-Mercapto-heptanoic acid biphenyl-4-ylamide	DMJMOUK	Discovery agent	N.A.	Investigative	[26]
7-Mercapto-heptanoic acid phenylamide	DM4912P	Discovery agent	N.A.	Investigative	[26]
7-Mercapto-heptanoic acid pyridin-3-ylamide	DMQ9PLA	Discovery agent	N.A.	Investigative	[26]
7-Mercapto-heptanoic acid quinolin-3-ylamide	DMTAGJ1	Discovery agent	N.A.	Investigative	[26]
7-mercapto-N-(4-phenylthiazol-2-yl)heptanamide	DM03XYF	Discovery agent	N.A.	Investigative	[37]
7-Phenoxy-heptanoic acid hydroxyamide	DM1FL5G	Discovery agent	N.A.	Investigative	[36]
8-(3-Benzoyl-ureido)-octanoic acid hydroxyamide	DMW2NJR	Discovery agent	N.A.	Investigative	[31]
8-(4-bromophenyl)-N-hydroxy-8-oxooctanamide	DMVOCWY	Discovery agent	N.A.	Investigative	[38]
8-(Biphenyl-3-yloxy)-1,1,1-trifluoro-octan-2-one	DMH3SDO	Discovery agent	N.A.	Investigative	[20]
8-(biphenyl-4-yl)-N-hydroxy-8-oxooctanamide	DMD6VSY	Discovery agent	N.A.	Investigative	[38]
8-(Biphenyl-4-yloxy)-1,1,1-trifluoro-octan-2-one	DM23XGW	Discovery agent	N.A.	Investigative	[20]
8-(Biphenyl-4-yloxy)-2-oxo-octanoic acid	DMDIGPW	Discovery agent	N.A.	Investigative	[35]
8-Mercapto-octanoic acid phenylamide	DMD3FWU	Discovery agent	N.A.	Investigative	[26]
8-Oxo-8-phenyl-octanoic acid	DMXDQ25	Discovery agent	N.A.	Investigative	[27]
8-Oxo-8-phenyl-octanoic acid hydroxyamide	DMWM1UL	Discovery agent	N.A.	Investigative	[25]
8-Phenyl-octanoic acid hydroxyamide	DM516NE	Discovery agent	N.A.	Investigative	[36]
9,9,9-Trifluoro-8-oxo-nonanoic acid phenylamide	DMVBCID	Discovery agent	N.A.	Investigative	[20]
9-(Biphenyl-4-yloxy)-1,1,1-trifluoro-nonan-2-one	DMIY3D6	Discovery agent	N.A.	Investigative	[20]
ADS-100380	DM7U4OT	Discovery agent	N.A.	Investigative	[39]
ADS-102550	DMEU6MH	Discovery agent	N.A.	Investigative	[39]
Azithromycin-N-benzyltriazolyldecahydroxamic Acid	DMDQ2VN	Discovery agent	N.A.	Investigative	[40]
Azithromycin-N-benzyltriazolylhexahydroxamic Acid	DM7KD5Y	Discovery agent	N.A.	Investigative	[40]
Azithromycin-N-benzyltriazolylnonahydroxamic Acid	DMW0HXO	Discovery agent	N.A.	Investigative	[40]
Azithromycin-N-benzyltriazolyloctahydroxamic Acid	DMAJ4LI	Discovery agent	N.A.	Investigative	[40]
Azithromycinarylalkylhydroxamic Acid	DM8ZQG3	Discovery agent	N.A.	Investigative	[40]
AZUMAMIDE B	DMXOGE8	Discovery agent	N.A.	Investigative	[41]
AZUMAMIDE C	DMEBA61	Discovery agent	N.A.	Investigative	[41]
AZUMAMIDE E	DMAX06G	Discovery agent	N.A.	Investigative	[41]
Cyclo(-L-Am7(S2Py)-A2in-L-Ala-D-Pro-)	DMZF35W	Discovery agent	N.A.	Investigative	[42]
Cyclo(-L-Am7(S2Py)-Aib-L-Ala-D-Pro-)	DMIVREK	Discovery agent	N.A.	Investigative	[42]
Cyclo(-L-Am7(S2Py)-Aib-L-Ala-D-Tic-)	DMLBECR	Discovery agent	N.A.	Investigative	[42]
Cyclo(-L-Am7(S2Py)-Aib-L-Ph4-D-Pro-)	DMA76KW	Discovery agent	N.A.	Investigative	[42]
Cyclo(-L-Am7(S2Py)-Aib-L-Ph5-D-Pro-)	DMLNJ0O	Discovery agent	N.A.	Investigative	[42]
Cyclo(-L-Am7(S2Py)-Aib-L-Phe-D-Pro-)	DMTVMWA	Discovery agent	N.A.	Investigative	[42]
Cyclo(-L-Am7(S2Py)-Aib-L-Phg-D-Pro-)	DMUSEDF	Discovery agent	N.A.	Investigative	[42]
Cyclo(-L-Am7(S2Py)-Aib-L-Ser(Bzl)-D-Pro-)	DMSEQ0W	Discovery agent	N.A.	Investigative	[42]
Cyclo(-L-Am7(S2Py)-Aib-L-Ser-D-Pro-)	DMBKP48	Discovery agent	N.A.	Investigative	[42]
Cyclo(-L-Am7(S2Py)-D-2MePhe-L-Ala-D-Pro-)	DMVY89X	Discovery agent	N.A.	Investigative	[42]
Cyclo(-L-Am7(S2Py)-D-A1in-L-Ala-D-Pro-)	DMTDIM9	Discovery agent	N.A.	Investigative	[42]
Cyclo(-L-Am7(S2Py)-L-2MePhe-L-Ala-D-Pro-)	DMV23XD	Discovery agent	N.A.	Investigative	[42]
Cyclo(-L-Am7(S2Py)-L-A1in-L-Ala-D-Pro-)	DM0VIH4	Discovery agent	N.A.	Investigative	[42]
Cyclostellettamine derivative	DMFTDPQ	Discovery agent	N.A.	Investigative	[43]
Desclasinose Azithromycinarylalkyl Hydroxamate	DMAB9KG	Discovery agent	N.A.	Investigative	[40]
Gymnochrome E	DM7SLAM	Discovery agent	N.A.	Investigative	[44]
LARGAZOLE	DMSYLIJ	Discovery agent	N.A.	Investigative	[45]
N,8-dihydroxy-8-(naphthalen-2-yl)octanamide	DM8G0WX	Discovery agent	N.A.	Investigative	[38]
N-(2,3-Dimethylphenyl)-N'-hydroxyoctanediamide	DM5R3ZG	Discovery agent	N.A.	Investigative	[46]
N-(2,4-Dimethylphenyl)-N'-hydroxyoctanediamide	DMXA9MR	Discovery agent	N.A.	Investigative	[46]
N-(2,5-Dimethylphenyl)-N'-hydroxyoctanediamide	DMOL79W	Discovery agent	N.A.	Investigative	[46]
N-(2,6-Dimethylphenyl)-N'-hydroxyoctanediamide	DMTBAPH	Discovery agent	N.A.	Investigative	[46]
N-(2-amino-5-(thiophen-2-yl)phenyl)nicotinamide	DMFYG79	Discovery agent	N.A.	Investigative	[47]
N-(2-aminophenyl)-4-(chroman-3-ylmethyl)benzamide	DMT7JUC	Discovery agent	N.A.	Investigative	[48]
N-(2-aminophenyl)-4-methoxybenzamide	DMTKWUM	Discovery agent	N.A.	Investigative	[49]
N-(2-aminophenyl)nicotinamide	DMRDQ1B	Discovery agent	N.A.	Investigative	[47]
N-(2-aminophenyl)quinoxaline-6-carboxamide	DMJXV7C	Discovery agent	N.A.	Investigative	[49]
N-(2-Ethylphenyl)-N'-hydroxyoctanediamide	DMDM50P	Discovery agent	N.A.	Investigative	[46]
N-(2-Mercapto-ethyl)-N'-phenyl-oxalamide	DM0GOPV	Discovery agent	N.A.	Investigative	[50]
N-(2-Mercapto-ethyl)-N'-phenyl-succinamide	DMJLFOQ	Discovery agent	N.A.	Investigative	[50]
N-(3,4-Dimethylphenyl)-N'-hydroxyoctanediamide	DMEP2VM	Discovery agent	N.A.	Investigative	[46]
N-(3,5-Dimethylphenyl)-N'-hydroxyoctanediamide	DM1L3FM	Discovery agent	N.A.	Investigative	[46]
N-(3-Ethylphenyl)-N'-hydroxyoctanediamide	DMC5G6Y	Discovery agent	N.A.	Investigative	[46]
N-(4-aminobiphenyl-3-yl)nicotinamide	DMXVZIY	Discovery agent	N.A.	Investigative	[47]
N-(4-Ethylphenyl)-N'-hydroxyoctanediamide	DMKN8U6	Discovery agent	N.A.	Investigative	[46]
N-(4-hydroxybiphenyl-3-yl)benzamide	DMC5H8G	Discovery agent	N.A.	Investigative	[47]
N-(5-Hydroxycarbamoyl-pentyl)-4-nitro-benzamide	DMSUW7M	Discovery agent	N.A.	Investigative	[25]
N-(6-Hydroxycarbamoyl-hexyl)-benzamide	DMIZVMT	Discovery agent	N.A.	Investigative	[27]
N-(6-Mercapto-hexyl)-benzamide	DM01Y37	Discovery agent	N.A.	Investigative	[26]
N-hydroxy-2,2'-bithiophene-5-carboxamide	DMWIMR4	Discovery agent	N.A.	Investigative	[39]
N-Hydroxy-4-((R)-2-phenyl-butyrylamino)-benzamide	DMCN91A	Discovery agent	N.A.	Investigative	[23]
N-Hydroxy-4-((S)-2-phenyl-butyrylamino)-benzamide	DMVK2Y3	Discovery agent	N.A.	Investigative	[23]
N-Hydroxy-4-(2-phenyl-butyrylamino)-benzamide	DMHEQ41	Discovery agent	N.A.	Investigative	[23]
N-Hydroxy-4-(3-phenyl-propionylamino)-benzamide	DMUOCQB	Discovery agent	N.A.	Investigative	[51]
N-Hydroxy-4-(4-phenyl-butyrylamino)-benzamide	DMVEOBY	Discovery agent	N.A.	Investigative	[23]
N-Hydroxy-4-(5-phenyl-pentanoylamino)-benzamide	DMISRMT	Discovery agent	N.A.	Investigative	[23]
N-Hydroxy-4-(pentanoylamino-methyl)-benzamide	DMGTNQY	Discovery agent	N.A.	Investigative	[24]
N-Hydroxy-4-(phenylacetylamino-methyl)-benzamide	DMDUOH4	Discovery agent	N.A.	Investigative	[24]
N-Hydroxy-4-phenylacetylamino-benzamide	DMCRU17	Discovery agent	N.A.	Investigative	[23]
N-hydroxy-5-(pyridin-2-yl)thiophene-2-carboxamide	DMYKJZ2	Discovery agent	N.A.	Investigative	[39]
N-hydroxy-5-(pyridin-3-yl)thiophene-2-carboxamide	DMK98LE	Discovery agent	N.A.	Investigative	[39]
N-hydroxy-5-(pyridin-4-yl)thiophene-2-carboxamide	DM653RM	Discovery agent	N.A.	Investigative	[39]
N-hydroxy-5-phenylthiophene-2-carboxamide	DMA2WUQ	Discovery agent	N.A.	Investigative	[39]
N-hydroxy-6-oxo-6-phenylhexanamide	DM0JNO2	Discovery agent	N.A.	Investigative	[38]
N-hydroxy-7-(4-methoxyphenyl)-7-oxoheptanamide	DMUXZL1	Discovery agent	N.A.	Investigative	[38]
N-hydroxy-7-(naphthalen-2-yl)-7-oxoheptanamide	DM8Z4L0	Discovery agent	N.A.	Investigative	[38]
N-hydroxy-7-(naphthalen-2-yloxy)heptanamide	DMBUNAP	Discovery agent	N.A.	Investigative	[34]
N-hydroxy-7-oxo-7-phenylheptanamide	DMQW7JZ	Discovery agent	N.A.	Investigative	[38]
N-hydroxy-8-(2-methoxyphenyl)-8-oxooctanamide	DMSIMNR	Discovery agent	N.A.	Investigative	[38]
N-hydroxy-8-(4-methoxyphenyl)-8-oxooctanamide	DMD2K4T	Discovery agent	N.A.	Investigative	[38]
N-hydroxy-8-(naphthalen-2-yl)non-8-enamide	DMRN1C6	Discovery agent	N.A.	Investigative	[38]
N-hydroxy-8-(naphthalen-2-yl)oct-7-enamide	DMGZY1Q	Discovery agent	N.A.	Investigative	[38]
N-hydroxy-8-(naphthalen-2-yl)octanamide	DMXQICK	Discovery agent	N.A.	Investigative	[38]
N-hydroxy-8-oxo-8-(pyridin-3-yl)octanamide	DMO4CR7	Discovery agent	N.A.	Investigative	[38]
N-hydroxy-9-oxo-9-phenylnonanamide	DMIC2A8	Discovery agent	N.A.	Investigative	[38]
N-Hydroxy-N'-(2-methylphenyl)octanediamide	DM865Y2	Discovery agent	N.A.	Investigative	[46]
N-Hydroxy-N'-(3-methylphenyl)octanediamide	DMYRC2M	Discovery agent	N.A.	Investigative	[46]
N-Hydroxy-N'-(4-methoxyphenyl)octanediamide	DMELB07	Discovery agent	N.A.	Investigative	[46]
N-Hydroxy-N'-(4-methylphenyl)octanediamide	DM3DPZ8	Discovery agent	N.A.	Investigative	[46]
N-hydroxybenzo[b]thiophene-2-carboxamide	DMR4J8G	Discovery agent	N.A.	Investigative	[52]
N1-(biphenyl-3-yl)-N8-hydroxyoctanediamide	DMMQXON	Discovery agent	N.A.	Investigative	[53]
N1-(biphenyl-4-yl)-N8-hydroxyoctanediamide	DMZA8NC	Discovery agent	N.A.	Investigative	[54]
N1-hydroxy-N8-(4-phenylthiazol-2-yl)octanediamide	DMOZARM	Discovery agent	N.A.	Investigative	[54]
nexturastat A	DM6NS7H	Discovery agent	N.A.	Investigative	[55]
NSC-746457	DM2GO7N	Discovery agent	N.A.	Investigative	[56]
Octanedioic acid bis-hydroxyamide	DMJNQ9K	Discovery agent	N.A.	Investigative	[57]
Octanedioic acid hydroxyamide pyridin-2-ylamide	DMHNWS1	Discovery agent	N.A.	Investigative	[27]
Octanedioic acid hydroxyamide pyridin-4-ylamide	DM945RK	Discovery agent	N.A.	Investigative	[27]
PSAMMAPLIN A	DM6T0IQ	Discovery agent	N.A.	Investigative	[25]
SK-683	DMM32CF	Discovery agent	N.A.	Investigative	[58]
ST-2986	DMNERM6	Discovery agent	N.A.	Investigative	[59]
ST-2987	DMWXTM8	Solid tumour/cancer	2A00-2F9Z	Investigative	[59]
ST-3050	DM19K2D	Discovery agent	N.A.	Investigative	[59]
Thioacetic acid S-(6-phenylcarbamoyl-hexyl) ester	DMBOKSF	Discovery agent	N.A.	Investigative	[26]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Renal cancer	2C82	Kidney	5.21E-01	0.1	0.23
Prostate cancer	2C82	Prostate	6.73E-02	0.24	0.59
Multiple myeloma	2C82	Bone marrow	1.54E-06	0.66	4.44
Type 2 diabetes	5A11	Liver tissue	6.27E-01	0.11	0.33
Polycythemia vera	2C82	Whole blood	3.55E-11	-0.48	-1.91
Liver cancer	2C82	Liver tissue	1.91E-11	0.44	1.3
Melanoma	2C82	Skin	7.87E-02	0.06	0.18

References

• [1] Protein methyltransferases as a target class for drug discovery. Nat Rev Drug Discov. 2009 Sep;8(9):724-32.
• [2] Emerging drugs in cutaneous T cell lymphoma. Expert Opin Emerg Drugs. 2008 Jun;13(2):345-61.
• [3] Histone deacetylase inhibitors in cancer therapy: latest developments, trends and medicinal chemistry perspective. Anticancer Agents Med Chem. 2007 Sep;7(5):576-92.
• [4] Anticancer activities of histone deacetylase inhibitors. Nat Rev Drug Discov. 2006 Sep;5(9):769-84.
• [5] Hughes B: 2009 FDA drug approvals. Nat Rev Drug Discov. 2010 Feb;9(2):89-92.
• [6] Discovery of a potent class I selective ketone histone deacetylase inhibitor with antitumor activity in vivo and optimized pharmacokinetic properties. J Med Chem. 2009 Jun 11;52(11):3453-6.
• [7] Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.
• [8] Emerging drugs for the therapy of primary and post essential thrombocythemia, post polycythemia vera myelofibrosis. Expert Opin Emerg Drugs. 2009 Sep;14(3):471-9.
• [9] Emerging therapies for multiple myeloma. Expert Opin Emerg Drugs. 2009 Mar;14(1):99-127.
• [10] NVP-LAQ824 is a potent novel histone deacetylase inhibitor with significant activity against multiple myeloma. Blood. 2003 Oct 1;102(7):2615-22.
• [11] Emerging disease-modifying therapies for the treatment of motor neuron disease/amyotropic lateral sclerosis. Expert Opin Emerg Drugs. 2007 May;12(2):229-52.
• [12] 2011 Pipeline of 4SC AG.
• [13] Two histone deacetylase inhibitors, trichostatin A and sodium butyrate, suppress differentiation into osteoclasts but not into macrophages. Blood. 2003 May 1;101(9):3451-9.
• [14] A phase I pharmacokinetic and pharmacodynamic study of CHR-3996, an oral class I selective histone deacetylase inhibitor in refractory solid tumors. Clin Cancer Res. 2012 May 1;18(9):2687-94.
• [15] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2658).
• [16] Novel histone deacetylase 6 (HDAC6) selective inhibitors: a patent evaluation (WO2014181137).Expert Opin Ther Pat. 2017 Mar;27(3):229-236.
• [17] Cyclin-dependent kinase inhibitors for cancer therapy: a patent review (2009 - 2014).Expert Opin Ther Pat. 2015;25(9):953-70.
• [18] HDAC inhibitors: a 2013-2017 patent survey.Expert Opin Ther Pat. 2018 Apr 19:1-17.
• [19] Heterocyclic ketones as inhibitors of histone deacetylase. Bioorg Med Chem Lett. 2003 Nov 17;13(22):3909-13.
• [20] Trifluoromethyl ketones as inhibitors of histone deacetylase. Bioorg Med Chem Lett. 2002 Dec 2;12(23):3443-7.
• [21] New sulfurated derivatives of valproic acid with enhanced histone deacetylase inhibitory activity. Bioorg Med Chem Lett. 2008 Mar 15;18(6):1893-7.
• [22] Design and synthesis of a novel class of histone deacetylase inhibitors. Bioorg Med Chem Lett. 2001 Nov 5;11(21):2847-50.
• [23] Structure-based optimization of phenylbutyrate-derived histone deacetylase inhibitors. J Med Chem. 2005 Aug 25;48(17):5530-5.
• [24] Zn2+-chelating motif-tethered short-chain fatty acids as a novel class of histone deacetylase inhibitors. J Med Chem. 2004 Jan 15;47(2):467-74.
• [25] Histone deacetylase inhibitors. J Med Chem. 2003 Nov 20;46(24):5097-116.
• [26] Novel inhibitors of human histone deacetylases: design, synthesis, enzyme inhibition, and cancer cell growth inhibition of SAHA-based non-hydroxama... J Med Chem. 2005 Feb 24;48(4):1019-32.
• [27] Inhibitors of human histone deacetylase: synthesis and enzyme and cellular activity of straight chain hydroxamates. J Med Chem. 2002 Feb 14;45(4):753-7.
• [28] Chemical phylogenetics of histone deacetylases. Nat Chem Biol. 2010 Mar;6(3):238-243.
• [29] Design of novel histone deacetylase inhibitors. Bioorg Med Chem Lett. 2007 Aug 15;17(16):4619-24.
• [30] Stereodefined and polyunsaturated inhibitors of histone deacetylase based on (2E,4E)-5-arylpenta-2,4-dienoic acid hydroxyamides. Bioorg Med Chem Lett. 2004 May 17;14(10):2477-81.
• [31] Acylurea connected straight chain hydroxamates as novel histone deacetylase inhibitors: Synthesis, SAR, and in vivo antitumor activity. Bioorg Med Chem Lett. 2010 Jun 1;20(11):3314-21.
• [32] Inhibitors selective for HDAC6 in enzymes and cells. Bioorg Med Chem Lett. 2010 Dec 1;20(23):7067-70.
• [33] Aromatic sulfide inhibitors of histone deacetylase based on arylsulfinyl-2,4-hexadienoic acid hydroxyamides. J Med Chem. 2006 Jan 26;49(2):800-5.
• [34] Structure-activity relationships of aryloxyalkanoic acid hydroxyamides as potent inhibitors of histone deacetylase. Bioorg Med Chem Lett. 2007 Jan 1;17(1):136-41.
• [35] Alpha-keto amides as inhibitors of histone deacetylase. Bioorg Med Chem Lett. 2003 Oct 6;13(19):3331-5.
• [36] A novel series of histone deacetylase inhibitors incorporating hetero aromatic ring systems as connection units. Bioorg Med Chem Lett. 2003 Nov 3;13(21):3817-20.
• [37] Design, synthesis, structure--selectivity relationship, and effect on human cancer cells of a novel series of histone deacetylase 6-selective inhib... J Med Chem. 2007 Nov 1;50(22):5425-38.
• [38] 3D-QSAR studies of HDACs inhibitors using pharmacophore-based alignment. Eur J Med Chem. 2009 Jul;44(7):2868-76.
• [39] Identification and optimisation of a series of substituted 5-pyridin-2-yl-thiophene-2-hydroxamic acids as potent histone deacetylase (HDAC) inhibit... Bioorg Med Chem Lett. 2007 Jan 15;17(2):363-9.
• [40] Non-peptide macrocyclic histone deacetylase inhibitors. J Med Chem. 2009 Jan 22;52(2):456-68.
• [41] Evaluation of antiangiogenic activity of azumamides by the in vitro vascular organization model using mouse induced pluripotent stem (iPS) cells. Bioorg Med Chem Lett. 2008 May 1;18(9):2982-4.
• [42] Molecular design of histone deacetylase inhibitors by aromatic ring shifting in chlamydocin framework. Bioorg Med Chem. 2007 Dec 15;15(24):7830-9.
• [43] Three new cyclostellettamines, which inhibit histone deacetylase, from a marine sponge of the genus Xestospongia. Bioorg Med Chem Lett. 2004 May 17;14(10):2617-20.
• [44] Gymnochromes E and F, cytotoxic phenanthroperylenequinones from a deep-water crinoid, Holopus rangii. J Nat Prod. 2010 Apr 23;73(4):712-5.
• [45] Synthesis and biological characterization of the histone deacetylase inhibitor largazole and C7- modified analogues. J Med Chem. 2010 Jun 24;53(12):4654-67.
• [46] Biological and biophysical properties of the histone deacetylase inhibitor suberoylanilide hydroxamic acid are affected by the presence of short al... J Med Chem. 2010 Mar 11;53(5):1937-50.
• [47] Bioorg Med Chem Lett. 2008 Dec 1;18(23):6104-9. Epub 2008 Oct 14.SAR profiles of spirocyclic nicotinamide derived selective HDAC1/HDAC2 inhibitors (SHI-1:2).
• [48] N-(2-Amino-phenyl)-4-(heteroarylmethyl)-benzamides as new histone deacetylase inhibitors. Bioorg Med Chem Lett. 2007 Dec 15;17(24):6729-33.
• [49] Novel aminophenyl benzamide-type histone deacetylase inhibitors with enhanced potency and selectivity. J Med Chem. 2007 Nov 15;50(23):5543-6.
• [50] Mercaptoamide-based non-hydroxamic acid type histone deacetylase inhibitors. Bioorg Med Chem Lett. 2005 Apr 15;15(8):1969-72.
• [51] Design, synthesis and preliminary biological evaluation of N-hydroxy-4-(3-phenylpropanamido)benzamide (HPPB) derivatives as novel histone deacetyla... Eur J Med Chem. 2009 Nov;44(11):4470-6.
• [52] Histone deacetylase inhibitors: from bench to clinic. J Med Chem. 2008 Mar 27;51(6):1505-29.
• [53] Sulfamides as novel histone deacetylase inhibitors. Bioorg Med Chem Lett. 2009 Jan 15;19(2):336-40.
• [54] Isoxazole moiety in the linker region of HDAC inhibitors adjacent to the Zn-chelating group: effects on HDAC biology and antiproliferative activity. Bioorg Med Chem Lett. 2009 Jun 1;19(11):3023-6.
• [55] Selective histone deacetylase 6 inhibitors bearing substituted urea linkers inhibit melanoma cell growth. J Med Chem. 2012 Nov 26;55(22):9891-9.
• [56] Histone deacetylase inhibitors through click chemistry. J Med Chem. 2008 Dec 11;51(23):7417-27.
• [57] Structure-activity relationships on phenylalanine-containing inhibitors of histone deacetylase: in vitro enzyme inhibition, induction of differenti... J Med Chem. 2002 Jul 18;45(15):3296-309.
• [58] On the function of the 14 A long internal cavity of histone deacetylase-like protein: implications for the design of histone deacetylase inhibitors. J Med Chem. 2004 Jun 17;47(13):3409-17.
• [59] N-Hydroxy-(4-oxime)-cinnamide: a versatile scaffold for the synthesis of novel histone deacetylase [correction of deacetilase] (HDAC) inhibitors. Bioorg Med Chem Lett. 2009 Apr 15;19(8):2346-9.