Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTUTJGQ)

• DTT Name: Vascular endothelial growth factor receptor 2 (KDR)
• Synonyms: VEGFR2; VEGFR-2; VEGF-2 receptor; Protein-tyrosine kinase receptor flk-1; Kinase insert domain receptor; Fetal liver kinase 1; FLK1; FLK-1; CD309
• Gene Name: KDR
• DTT Type: Successful target; [1]
• Related Disease:
  Breast cancer [ICD-11: 2C60-2C6Y]
  Colorectal cancer [ICD-11: 2B91]
  Gastrointestinal stromal tumour [ICD-11: 2B5B]
  Malignant digestive organ neoplasm [ICD-11: 2C11]
  Renal cell carcinoma [ICD-11: 2C90]
  Solid tumour/cancer [ICD-11: 2A00-2F9Z]
  Stomach cancer [ICD-11: 2B72]
  Thrombocytopenia [ICD-11: 3B64]
  Thyroid cancer [ICD-11: 2D10]
• BioChemical Class: Kinase
• UniProt ID: VGFR2_HUMAN
• TTD ID: T80975
• EC Number: EC 2.7.10.1
• Sequence:
  MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLD
  WLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQD
  YRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWD
  SKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGE
  KLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRS
  DQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLGYPPP
  EIKWYKNGIPLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVP
  PQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECANEPSQAVSVTNPY
  PCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGRGE
  RVISFHVTRGPEITLQPDMQPTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPT
  PVCKNLDTLWKLNATMFSNSTNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLT
  VLERVAPTITGNLENQTTSIGESIEVSCTASGNPPPQIMWFKDNETLVEDSGIVLKDGNR
  NLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKTNLEIIILVGTAVIAMFFWL
  LLVIILRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPL
  GRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVN
  LLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGAIPVDLK
  RRLDSITSSQSSASSGFVEEKSLSDVEEEEAPEDLYKDFLTLEHLICYSFQVAKGMEFLA
  SRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDR
  VYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTML
  DCWHGEPSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVS
  CMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDS
  GMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYS
  SEEAELLKLIEIGVQTGSTAQILQPDSGTTLSSPPV
• Function: Plays an essential role in the regulation of angiogenesis, vascular development, vascular permeability, and embryonic hematopoiesis. Promotes proliferation, survival, migration and differentiation of endothelial cells. Promotes reorganization of the actin cytoskeleton. Isoforms lacking a transmembrane domain, such as isoform 2 and isoform 3, may function as decoy receptors for VEGFA, VEGFC and/or VEGFD. Isoform 2 plays an important role as negative regulator of VEGFA- and VEGFC-mediated lymphangiogenesis by limiting the amount of free VEGFA and/or VEGFC and preventing their binding to FLT4. Modulates FLT1 and FLT4 signaling by forming heterodimers. Binding of vascular growth factors to isoform 1 leads to the activation of several signaling cascades. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate and the activation of protein kinase C. Mediates activation of MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling pathway, as well as of the AKT1 signaling pathway. Mediates phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, reorganization of the actin cytoskeleton and activation of PTK2/FAK1. Required for VEGFA-mediated induction of NOS2 and NOS3, leading to the production of the signaling molecule nitric oxide (NO) by endothelial cells. Phosphorylates PLCG1. Promotes phosphorylation of FYN, NCK1, NOS3, PIK3R1, PTK2/FAK1 and SRC. Tyrosine-protein kinase that acts as a cell-surface receptor for VEGFA, VEGFC and VEGFD.
• KEGG Pathway:
  Ras signaling pathway (hsa04014)
  Rap1 signaling pathway (hsa04015)
  Cytokine-cytokine receptor interaction (hsa04060)
  Endocytosis (hsa04144)
  PI3K-Akt signaling pathway (hsa04151)
  VEGF signaling pathway (hsa04370)
  Focal adhesion (hsa04510)
  Proteoglycans in cancer (hsa05205)
• Reactome Pathway:
  VEGF binds to VEGFR leading to receptor dimerization (R-HSA-195399)
  Integrin cell surface interactions (R-HSA-216083)
  EPHA-mediated growth cone collapse (R-HSA-3928663)
  VEGFA-VEGFR2 Pathway (R-HSA-4420097)
  VEGFR2 mediated cell proliferation (R-HSA-5218921)
  Neurophilin interactions with VEGF and VEGFR (R-HSA-194306)

Molecular Interaction Atlas (MIA) of This DTT

12 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Axitinib	DMGVH6N	Renal cell carcinoma	2C90	Approved	[2], [3]
Cabozantinib	DMIYDT4	Thyroid cancer	2D10	Approved	[4], [5]
Lenvatinib	DMB1IU4	Thyroid cancer	2D10	Approved	[1]
Pazopanib HCl	DM6U9CQ	Renal cell carcinoma	2C90	Approved	[6]
Ramucirumab	DMWUFQ4	Gastric adenocarcinoma	2B72	Approved	[7]
Regorafenib	DMHSY1I	Metastatic colorectal cancer	2B91	Approved	[8]
Romiplostim	DM3U7SZ	Thrombocytopenia	3B64	Approved	[9]
Sorafenib	DMS8IFC	Hepatocellular carcinoma	2C12.02	Approved	[10], [11]
Sunitinib	DMCBJSR	Gastrointestinal cancer	2C11	Approved	[12], [13]
Tivozanib	DMUKC5L	Renal cell carcinoma	2C90	Approved	[14]
Vandetanib	DMRICNP	Solid tumour/cancer	2A00-2F9Z	Approved	[15], [16]
Yn-968D1	DMMP3Y2	Breast cancer	2C60-2C65	Approved	[17]

35 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Brivanib	DM942HP	Breast cancer	2C60-2C65	Phase 3	[18]
Cediranib	DMWO5ZR	Peritoneal cavity cancer	2C51.Z	Phase 3	[15], [16]
E-3810	DM42PFT	Solid tumour/cancer	2A00-2F9Z	Phase 3	[19]
Fruquintinib	DMHOSCQ	Solid tumour/cancer	2A00-2F9Z	Phase 3	[20]
HKI-272	DM6QOVN	Breast cancer	2C60-2C65	Phase 3	[21]
Rivoceranib	DM13V0P	Gastric adenocarcinoma	2B72	Phase 3	[22]
Rosiglitazone + metformin	DMPIDXT	Diabetic complication	5A2Y	Phase 3	[15], [23]
Sulfatinib	DMPOTM4	Neuroendocrine cancer	2B72.1	Phase 3	[24]
MGCD516	DM752PU	Solid tumour/cancer	2A00-2F9Z	Phase 2/3	[25]
Alacizumab pegol	DM3P91Z	Non-small-cell lung cancer	2C25.Y	Phase 2	[26]
BAY-57-9352	DMVA5NS	Gastric adenocarcinoma	2B72	Phase 2	[15]
BMS-690514	DMX302C	Chronic pain	MG30	Phase 2	[27]
CP-547632	DMX054A	Non-small-cell lung cancer	2C25.Y	Phase 2	[15], [28]
Delphinidin	DMS2WIN	Cardiovascular disease	BA00-BE2Z	Phase 2	[29]
Famitinib	DMSFWT7	Solid tumour/cancer	2A00-2F9Z	Phase 2	[30]
L-DOS47	DMIEZUB	Non-small-cell lung cancer	2C25.Y	Phase 2	[31]
RAF265	DMC56T4	Melanoma	2C30	Phase 2	[32]
TTAC-0001	DM6TAFE	Recurrent glioblastoma	2A00.00	Phase 2	[25]
VATALANIB	DMY0UEQ	Solid tumour/cancer	2A00-2F9Z	Phase 2	[21]
XL880	DMHJTR2	Breast cancer	2C60-2C65	Phase 2	[18]
Anti-VEGFR2 CD8 cell therapy	DM2910G	Solid tumour/cancer	2A00-2F9Z	Phase 1/2	[33], [34]
Elpamotide	DM5FCO4	Biliary cancer	2E92.7	Phase 1/2	[35]
MK-2461	DM21WBH	Alzheimer disease	8A20	Phase 1/2	[36]
OTSGC-A24	DMN0ZQ5	Colorectal cancer	2B91.Z	Phase 1/2	[37]
Altiratinib	DMUJCBT	Solid tumour/cancer	2A00-2F9Z	Phase 1	[38]
CEP-11981	DMYDTJ6	Solid tumour/cancer	2A00-2F9Z	Phase 1	[15]
CYC116	DMUMHXT	Solid tumour/cancer	2A00-2F9Z	Phase 1	[39]
E-7050	DMDOCNW	Head and neck cancer	2D42	Phase 1	[40]
KRN633	DMODGJU	Glioma	2A00.0	Phase 1	[15]
OSI-930	DMF2CZ9	Solid tumour/cancer	2A00-2F9Z	Phase 1	[41], [42]
Pegdinetanib	DM0E37K	Non-small-cell lung cancer	2C25.Y	Phase 1	[25]
PF-00337210	DM5PUO0	Solid tumour/cancer	2A00-2F9Z	Phase 1	[43]
PLX-4720	DMBK9AM	Cutaneous melanoma	2C30	Phase 1	[13]
TAK-593	DMNFZOT	Solid tumour/cancer	2A00-2F9Z	Phase 1	[44], [45]
XL999	DMYS13R	Advanced malignancy	2A00-2F9Z	Phase 1	[46]

10 Patented Agent(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Antibodie derivative 10	DMGP5AR	Angiogenesis disorder	BE2Z	Patented	[47]
Antibodie derivative 6	DMUG6YT	N. A.	N. A.	Patented	[47]
Pyridine derivative 18	DMBZMYT	N. A.	N. A.	Patented	[48]
Pyrimidine derivative 12	DMMBFQH	N. A.	N. A.	Patented	[47]
Pyrimidine derivative 13	DMASGR1	N. A.	N. A.	Patented	[47]
Pyrimidine derivative 14	DM7B2XG	N. A.	N. A.	Patented	[47]
Pyrimidine derivative 4	DM8K6IS	N. A.	N. A.	Patented	[47]
Quinazoline derivative 15	DMD965S	N. A.	N. A.	Patented	[48]
Quinazoline derivative 16	DMQ704Z	N. A.	N. A.	Patented	[48]
Quinoline and quinazoline derivative 1	DMKDTO4	N. A.	N. A.	Patented	[47]

5 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Motesanib	DMZAL8C	Non-small-cell lung cancer	2C25.Y	Discontinued in Phase 3	[49], [50], [51]
SU-14813	DMNRW68	Breast cancer	2C60-2C65	Discontinued in Phase 2	[15], [52], [53]
IMC-1C11	DMQIXD2	Solid tumour/cancer	2A00-2F9Z	Discontinued in Phase 1	[54]
AG1295	DMT10C2	N. A.	N. A.	Terminated	[55]
CEP-5214	DMFRW0G	Solid tumour/cancer	2A00-2F9Z	Terminated	[56]

71 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(2-Methoxy-phenyl)-(5-phenyl-oxazol-2-yl)-amine	DMQWD75	Discovery agent	N.A.	Investigative	[57]
(3-Phenoxy-phenyl)-(5-phenyl-oxazol-2-yl)-amine	DMGYAP7	Discovery agent	N.A.	Investigative	[57]
(4-Phenoxy-phenyl)-quinazolin-4-yl-amine	DMFO8DR	Discovery agent	N.A.	Investigative	[58]
(5-Phenyl-oxazol-2-yl)-m-tolyl-amine	DM1R5SF	Discovery agent	N.A.	Investigative	[57]
2-(1H-indazol-3-yl)-1H-benzo[d]imidazole	DM0CSH8	Discovery agent	N.A.	Investigative	[59]
2-(5-Phenyl-oxazol-2-ylamino)-benzonitrile	DMX6QMT	Discovery agent	N.A.	Investigative	[57]
2-(p-toluidino)-4-phenylpyrimidine-5-carbonitrile	DM27YTF	Discovery agent	N.A.	Investigative	[60]
2-(pyrimidin-4-ylamino)thiazole-5-carbonitrile	DMET46L	Discovery agent	N.A.	Investigative	[61]
3,4-di-(4-methoxyphenyl)-1H-pyrrole-2,5-dione	DMDO175	Discovery agent	N.A.	Investigative	[62]
3,4-diphenyl-1H-pyrrole-2,5-dione	DMPK6YT	Discovery agent	N.A.	Investigative	[62]
3,6-Di-pyridin-4-yl-pyrazolo[1,5-a]pyrimidine	DMNV0EZ	Discovery agent	N.A.	Investigative	[63]
3-((3-bromothiophen-2-yl)methylene)indolin-2-one	DME3079	Discovery agent	N.A.	Investigative	[64]
3-(1H-Indol-2-yl)-1H-quinolin-2-one	DMS3JCN	Discovery agent	N.A.	Investigative	[65]
3-(4-aminophenyl)thieno[3,2-c]pyridin-4-amine	DM30GV2	Discovery agent	N.A.	Investigative	[66]
3-(4-methoxyphenyl)-4-phenyl-1H-pyrrole-2,5-dione	DMGC7RY	Discovery agent	N.A.	Investigative	[62]
3-(5-Phenyl-oxazol-2-ylamino)-benzonitrile	DMPBLM2	Discovery agent	N.A.	Investigative	[57]
3-(5-Thiophen-3-yl-pyridin-3-yl)-1H-indole	DM9LVR5	Discovery agent	N.A.	Investigative	[67]
3-Benzimidazol-2-ylhydroquinolin-2-one	DMQXJA1	Discovery agent	N.A.	Investigative	[68]
3-methyl-1H-thieno[2,3-c]pyrazole-5-carboxamide	DMKOX0N	Discovery agent	N.A.	Investigative	[69]
3-phenyl-1,4-dihydroindeno[1,2-c]pyrazole	DMD0OZ8	Discovery agent	N.A.	Investigative	[70]
4-(4-aminophenyl)-1H-indazol-3yl-amine	DMK1IWD	Discovery agent	N.A.	Investigative	[71]
4-(4-m-Tolylamino-phthalazin-1-yl)-benzamide	DM3KCL1	Discovery agent	N.A.	Investigative	[72]
4-(4-p-Tolylamino-phthalazin-1-yl)-benzamide	DM6ESXB	Discovery agent	N.A.	Investigative	[72]
4-(5-Phenyl-oxazol-2-ylamino)-benzenesulfonamide	DM3N9O5	Discovery agent	N.A.	Investigative	[57]
4-(isoquinolin-5-yl)-N-m-tolylphthalazin-1-amine	DM8LODU	Discovery agent	N.A.	Investigative	[73]
4-(isoquinolin-5-yl)-N-o-tolylphthalazin-1-amine	DMS30HQ	Discovery agent	N.A.	Investigative	[73]
4-Chloro-N-(2-chloro-benzoyl)-benzenesulfonamide	DMVJ61A	Discovery agent	N.A.	Investigative	[74]
4-Chloro-N-(2-methyl-benzoyl)-benzenesulfonamide	DM6SI78	Discovery agent	N.A.	Investigative	[74]
4-Chloro-N-(3-chloro-benzoyl)-benzenesulfonamide	DMI3OR9	Discovery agent	N.A.	Investigative	[74]
4-Chloro-N-(4-chloro-benzoyl)-benzenesulfonamide	DMTDX2S	Discovery agent	N.A.	Investigative	[74]
4-Chloro-N-(4-nitro-benzoyl)-benzenesulfonamide	DMM0TL6	Discovery agent	N.A.	Investigative	[74]
4-phenyl-2-(phenylamino)pyrimidine-5-carbonitrile	DMONKDQ	Discovery agent	N.A.	Investigative	[60]
4-[3-Hydroxyanilino]-6,7-Dimethoxyquinazoline	DMTIA27	Discovery agent	N.A.	Investigative	[64]
5-(4-Methoxy-phenyl)-1-phenyl-1H-benzoimidazole	DMCMNKA	Discovery agent	N.A.	Investigative	[75]
6-(1H-Benzoimidazol-2-yl)-benzocyclohepten-7-one	DM5RX0K	Discovery agent	N.A.	Investigative	[65]
6-o-tolylquinazolin-2-amine	DM4TX9O	Discovery agent	N.A.	Investigative	[76]
8-methyl-4H,7H-indolo[6,5,4-cd]indol-5-one	DMA28OL	Discovery agent	N.A.	Investigative	[64]
AAL-993	DM35RFH	Discovery agent	N.A.	Investigative	[9]
AG-E-85378	DM83951	Discovery agent	N.A.	Investigative	[77]
AMG-429	DME04BH	Solid tumour/cancer	2A00-2F9Z	Investigative	[25]
AST-487	DME76KU	Discovery agent	N.A.	Investigative	[78]
BIBF-1202	DMDTLSP	Discovery agent	N.A.	Investigative	[79]
BMS-536924	DMXJB4N	Discovery agent	N.A.	Investigative	[80]
BMS-645737	DMBTMO9	Discovery agent	N.A.	Investigative	[81]
BX-795	DMRIMLJ	Discovery agent	N.A.	Investigative	[82]
BX-912	DMZA45C	Discovery agent	N.A.	Investigative	[82]
CB-676475	DMXON4L	Discovery agent	N.A.	Investigative	[83]
CEP-5104	DMV43GY	Discovery agent	N.A.	Investigative	[84]
EPI-0030	DM72DO1	Solid tumour/cancer	2A00-2F9Z	Investigative	[25]
IM-023911	DMZW0YO	Discovery agent	N.A.	Investigative	[72]
IM-094261	DMTFV65	Discovery agent	N.A.	Investigative	[72]
IM-094882	DMO18YN	Discovery agent	N.A.	Investigative	[73]
Indolin-2-one deriv. 4b	DMML9AY	Discovery agent	N.A.	Investigative	[85]
Isoindolinone Urea derivative	DMQC4HV	Discovery agent	N.A.	Investigative	[86]
JNJ-38158471	DM48Y9E	Angiogenesis disorder	BE2Z	Investigative	[25]
K-252a analogue	DMCZPH4	Discovery agent	N.A.	Investigative	[87]
Ki-20227	DM9M3VC	Discovery agent	N.A.	Investigative	[88]
L000021649	DMYWD6C	Discovery agent	N.A.	Investigative	[63]
N-(2,4-Dichloro-benzoyl)-benzenesulfonamide	DMHI4Y6	Discovery agent	N.A.	Investigative	[74]
N-(3-Bromo-benzoyl)-4-chloro-benzenesulfonamide	DMOQ08F	Discovery agent	N.A.	Investigative	[74]
Phenyl-(5-phenyl-oxazol-2-yl)-amine	DMR2B4O	Discovery agent	N.A.	Investigative	[57]
PMID22765894C8h	DMH5RFU	Discovery agent	N.A.	Investigative	[89]
PMID23639540C13a	DMLXOAQ	Discovery agent	N.A.	Investigative	[90]
PP121	DMU8KTO	Discovery agent	N.A.	Investigative	[91]
Pyrazolo[1,5-a]pyrimidine 3G	DMUB0EJ	Discovery agent	N.A.	Investigative	[63]
R-84	DM1MIRJ	Solid tumour/cancer	2A00-2F9Z	Investigative	[25]
Ro-4396686	DM5DMCH	Discovery agent	N.A.	Investigative	[92]
SU-11652	DMGQXN7	Discovery agent	N.A.	Investigative	[93]
TG-100435	DMIR3X2	Discovery agent	N.A.	Investigative	[94]
VEGF receptor 2 kinase inhibitor I	DMWXCYA	Discovery agent	N.A.	Investigative	[95]
[3-(5-Phenyl-oxazol-2-ylamino)-phenyl]-methanol	DMD0LCU	Discovery agent	N.A.	Investigative	[57]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Rectal cancer	2C82	Rectal colon tissue	2.74E-02	0.49	1.48
Renal cancer	2C82	Kidney	7.90E-01	0.18	0.27
Alzheimer's disease	8A00.0	Entorhinal cortex	1.98E-01	0.11	0.2
Ovarian cancer	2C82	Ovarian tissue	1.18E-01	-0.29	-0.43
Liver cancer	2C82	Liver tissue	2.93E-13	-0.77	-1.4
Myelodysplastic syndrome	2C82	Bone marrow	7.93E-05	0.11	0.37
Acute myelocytic leukaemia	2C82	Bone marrow	2.27E-01	0.03	0.14
Head and neck cancer	2C82	Head and neck tissue	7.27E-04	0.26	0.31
Melanoma	2C82	Skin	1.84E-01	0.2	0.15
Thyroid cancer	2C82	Thyroid	1.50E-03	0.44	0.82
Glioma	2C82	Brainstem tissue	6.79E-01	0.05	0.19
Glioma	2C82	White matter	7.67E-01	0.61	0.61
Gastric cancer	2C82	Gastric tissue	4.05E-01	-0.21	-1
Breast cancer	2C82	Breast tissue	6.54E-27	-0.71	-0.79
Lung cancer	2C82	Lung tissue	2.37E-83	-1.61	-2.54
Psoriasis	EA90	Skin	8.32E-09	-0.33	-0.66
Retinoblastoma	2C82	Uvea	4.37E-09	-4.77	-8.72

References

• [1] Emerging drugs for ovarian cancer. Expert Opin Emerg Drugs. 2008 Sep;13(3):523-36.
• [2] Nat Rev Drug Discov. 2013 Feb;12(2):87-90.
• [3] Axitinib: VEGF inhibition in advanced thyroid cancer. Lancet Oncol. 2014 Jul;15(8):e310.
• [4] Clinical pipeline report, company report or official report of Exelixis (2011).
• [5] Tropomyosin receptor kinase inhibitors: an updated patent review for 2010-2016 - Part I.Expert Opin Ther Pat. 2017 Jun;27(6):733-751.
• [6] Hughes B: 2009 FDA drug approvals. Nat Rev Drug Discov. 2010 Feb;9(2):89-92.
• [7] 2014 FDA drug approvals. Nat Rev Drug Discov. 2015 Feb;14(2):77-81.
• [8] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
• [9] Anthranilic acid amides: a novel class of antiangiogenic VEGF receptor kinase inhibitors. J Med Chem. 2002 Dec 19;45(26):5687-93.
• [10] Preclinical overview of sorafenib, a multikinase inhibitor that targets both Raf and VEGF and PDGF receptor tyrosine kinase signaling.Mol Cancer Ther.2008 Oct;7(10):3129-40.
• [11] Sorafenib (BAY 43-9006, Nexavar), a dual-action inhibitor that targets RAF/MEK/ERK pathway in tumor cells and tyrosine kinases VEGFR/PDGFR in tumor vasculature. Methods Enzymol. 2006;407:597-612.
• [12] 2006 drug approvals: finding the niche. Nat Rev Drug Discov. 2007 Feb;6(2):99-101.
• [13] In vivo antitumor activity of SU11248, a novel tyrosine kinase inhibitor targeting vascular endothelial growth factor and platelet-derived growth factor receptors: determination of a pharmacokinetic/pharmacodynamic relationship. Clin Cancer Res. 2003 Jan;9(1):327-37.
• [14] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services
• [15] A comparison of physicochemical property profiles of marketed oral drugs and orally bioavailable anti-cancer protein kinase inhibitors in clinical development. Curr Top Med Chem. 2007;7(14):1408-22.
• [16] Clinical pipeline report, company report or official report of AstraZeneca (2009).
• [17] YN968D1 is a novel and selective inhibitor of vascular endothelial growth factor receptor-2 tyrosine kinase with potent activity in vitro and in vivo. Cancer Sci. 2011 Jul;102(7):1374-80.
• [18] Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.
• [19] E-3810 is a potent dual inhibitor of VEGFR and FGFR that exerts antitumor activity in multiple preclinical models. Cancer Res. 2011 Feb 15;71(4):1396-405.
• [20] Discovery of fruquintinib, a potent and highly selective small molecule inhibitor of VEGFR 1, 2, 3 tyrosine kinases for cancer therapy. Cancer Biol Ther. 2014;15(12):1635-45.
• [21] Dual irreversible kinase inhibitors: quinazoline-based inhibitors incorporating two independent reactive centers with each targeting different cyst... Bioorg Med Chem. 2007 Jun 1;15(11):3635-48.
• [22] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [23] Dose-finding study of the multitargeted tyrosine kinase inhibitor SU6668 in patients with advanced malignancies. Clin Cancer Res. 2005 Sep 1;11(17):6240-6.
• [24] Clinical pipeline report, company report or official report of Hutchison Medi Pharma.
• [25] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1813).
• [26] Phase I evaluation of CDP791, a PEGylated di-Fab' conjugate that binds vascular endothelial growth factor receptor 2. Clin Cancer Res. 2007 Dec 1;13(23):7113-8.
• [27] Preclinical pharmacokinetics and in vitro metabolism of BMS-690514, a potent inhibitor of EGFR and VEGFR2. J Pharm Sci. 2010 Aug;99(8):3579-93.
• [28] YM-359445, an orally bioavailable vascular endothelial growth factor receptor-2 tyrosine kinase inhibitor, has highly potent antitumor activity against established tumors. Clin Cancer Res. 2006 Mar 1;12(5):1630-8.
• [29] Delphinidin, a dietary anthocyanidin, inhibits vascular endothelial growth factor receptor-2 phosphorylation. Carcinogenesis. 2006 May;27(5):989-96.
• [30] Metabolism and bioactivation of famitinib, a novel inhibitor of receptor tyrosine kinase, in cancer patients. Br J Pharmacol. 2013 Apr;168(7):1687-706.
• [31] Clinical pipeline report, company report or official report of Helix BioPharma.
• [32] RAF265, a dual BRAF and VEGFR2 inhibitor, prevents osteoclast formation and resorption. Therapeutic implications. Invest New Drugs. 2013 Feb;31(1):200-5.
• [33] Vascular normalizing doses of antiangiogenic treatment reprogram the immunosuppressive tumor microenvironment and enhance immunotherapy. Proc Natl Acad Sci U S A. 2012 Oct 23;109(43):17561-6.
• [34] ClinicalTrials.gov (NCT01218867) CAR T Cell Receptor Immunotherapy Targeting VEGFR2 for Patients With Metastatic Cancer. U.S. National Institutes of Health.
• [35] Clinical phase I study of elpamotide, a peptide vaccine for vascular endothelial growth factor receptor 2, in patients with advanced solid tumors. Cancer Sci. 2012 Dec;103(12):2135-8.
• [36] MK-2461, a novel multitargeted kinase inhibitor, preferentially inhibits the activated c-Met receptor. Cancer Res. 2010 Feb 15;70(4):1524-33.
• [37] J Clin Oncol 33, 2015 (suppl 3; abstr 65).
• [38] Clinical pipeline report, company report or official report of Deciphera Pharmaceuticals.
• [39] Clinical pipeline report, company report or official report of Cyclacel.
• [40] E7050: a dual c-Met and VEGFR-2 tyrosine kinase inhibitor promotes tumor regression and prolongs survival in mouse xenograft models. Cancer Sci. 2010 Jan;101(1):210-5.
• [41] OSI-930 analogues as novel reversal agents for ABCG2-mediated multidrug resistance. Biochem Pharmacol. 2012 Sep 15;84(6):766-74.
• [42] Inhibition of c-Kit, VEGFR-2 (KDR), and ABCG2 by analogues of OSI-930. Bioorg Med Chem Lett. 2011 Nov 1;21(21):6495-9.
• [43] Inhibition of VEGFR-2 Reverses Type 1 Diabetes in NOD Mice by Abrogating Insulitis and Restoring Islet Function. Diabetes. 2013 August; 62(8): 2870-2878.
• [44] Biochemical characterization of TAK-593, a novel VEGFR/PDGFR inhibitor with a two-step slow binding mechanism. Biochemistry. 2011 Feb 8;50(5):738-51.
• [45] Anti-angiogenic and anti-tumor effects of TAK-593, a potent and selective inhibitor of vascular endothelial growth factor and platelet-derived growth factor receptor tyrosine kinase. Cancer Sci. 2013Apr;104(4):486-94.
• [46] Gateways to clinical trials. Methods Find Exp Clin Pharmacol. 2007 Mar;29(2):153-73.
• [47] VEGFR-2 inhibitors and the therapeutic applications thereof: a patent review (2012-2016).Expert Opin Ther Pat. 2017 Sep;27(9):987-1004.
• [48] RET kinase inhibitors: a review of recent patents (2012-2015).Expert Opin Ther Pat. 2017 Jan;27(1):91-99.
• [49] Clinical pipeline report, company report or official report of Amgen (2009).
• [50] Phase II study of safety and efficacy of motesanib in patients with progressive or symptomatic, advanced or metastatic medullary thyroid cancer. J Clin Oncol. 2009 Aug 10;27(23):3794-801.
• [51] Axitinib for renal cell carcinoma. Expert Opin Investig Drugs. 2008 May;17(5):741-8.
• [52] Pfizer. Product Development Pipeline. March 31 2009.
• [53] SU14813: a novel multiple receptor tyrosine kinase inhibitor with potent antiangiogenic and antitumor activity. Mol Cancer Ther. 2006 Jul;5(7):1774-82.
• [54] Technology evaluation: IMC-1C11, ImClone Systems. Curr Opin Mol Ther. 2001 Aug;3(4):418-24.
• [55] Design, synthesis, and X-ray crystal structures of 2,4-diaminofuro[2,3-d]pyrimidines as multireceptor tyrosine kinase and dihydrofolate reductase i... Bioorg Med Chem. 2009 Oct 15;17(20):7324-36.
• [56] Neuropilin-2 interacts with VEGFR-2 and VEGFR-3 and promotes human endothelial cell survival and migration. Blood. 2006 Aug 15;108(4):1243-50.
• [57] Discovery and evaluation of 2-anilino-5-aryloxazoles as a novel class of VEGFR2 kinase inhibitors. J Med Chem. 2005 Mar 10;48(5):1610-9.
• [58] Pyrrolo[2,3-d]pyrimidines containing an extended 5-substituent as potent and selective inhibitors of lck I. Bioorg Med Chem Lett. 2000 Oct 2;10(19):2167-70.
• [59] Design and structure-activity relationship of 3-benzimidazol-2-yl-1H-indazoles as inhibitors of receptor tyrosine kinases. Bioorg Med Chem Lett. 2006 Jul 1;16(13):3595-9.
• [60] 4-Aryl-5-cyano-2-aminopyrimidines as VEGF-R2 inhibitors: synthesis and biological evaluation. Bioorg Med Chem Lett. 2007 Jun 15;17(12):3266-70.
• [61] Potent 2-[(pyrimidin-4-yl)amine}-1,3-thiazole-5-carbonitrile-based inhibitors of VEGFR-2 (KDR) kinase. Bioorg Med Chem Lett. 2006 Mar 1;16(5):1146-50.
• [62] Design, synthesis, and biological evaluation of 3,4-diarylmaleimides as angiogenesis inhibitors. J Med Chem. 2006 Feb 23;49(4):1271-81.
• [63] Optimization of a pyrazolo[1,5-a]pyrimidine class of KDR kinase inhibitors: improvements in physical properties enhance cellular activity and pharm... Bioorg Med Chem Lett. 2002 Dec 16;12(24):3537-41.
• [64] Pharmacophore modeling and in silico screening for new KDR kinase inhibitors. Bioorg Med Chem Lett. 2007 Apr 15;17(8):2126-33.
• [65] Optimization of the indolyl quinolinone class of KDR (VEGFR-2) kinase inhibitors: effects of 5-amido- and 5-sulphonamido-indolyl groups on pharmaco... Bioorg Med Chem Lett. 2004 Jan 19;14(2):351-5.
• [66] Thienopyridine urea inhibitors of KDR kinase. Bioorg Med Chem Lett. 2007 Mar 1;17(5):1246-9.
• [67] Discovery and evaluation of 3-(5-thien-3-ylpyridin-3-yl)-1H-indoles as a novel class of KDR kinase inhibitors. Bioorg Med Chem Lett. 2003 Sep 15;13(18):2973-6.
• [68] Design, structure-activity relationships and in vivo characterization of 4-amino-3-benzimidazol-2-ylhydroquinolin-2-ones: a novel class of receptor... J Med Chem. 2009 Jan 22;52(2):278-92.
• [69] Scaffold oriented synthesis. Part 1: Design, preparation, and biological evaluation of thienopyrazoles as kinase inhibitors. Bioorg Med Chem Lett. 2006 Jan 1;16(1):96-9.
• [70] Hit-to-lead optimization of 1,4-dihydroindeno[1,2-c]pyrazoles as a novel class of KDR kinase inhibitors. Bioorg Med Chem Lett. 2006 Aug 15;16(16):4371-5.
• [71] Discovery of N-(4-(3-amino-1H-indazol-4-yl)phenyl)-N'-(2-fluoro-5-methylphenyl)urea (ABT-869), a 3-aminoindazole-based orally active multitargeted ... J Med Chem. 2007 Apr 5;50(7):1584-97.
• [72] Arylphthalazines: identification of a new phthalazine chemotype as inhibitors of VEGFR kinase. Bioorg Med Chem Lett. 2005 Nov 1;15(21):4696-8.
• [73] Arylphthalazines. Part 2: 1-(Isoquinolin-5-yl)-4-arylamino phthalazines as potent inhibitors of VEGF receptors I and II. Bioorg Med Chem Lett. 2006 Mar 15;16(6):1579-81.
• [74] Acyl sulfonamide anti-proliferatives: benzene substituent structure-activity relationships for a novel class of antitumor agents. J Med Chem. 2004 Oct 21;47(22):5367-80.
• [75] Design and synthesis of 1,5-diarylbenzimidazoles as inhibitors of the VEGF-receptor KDR. Bioorg Med Chem Lett. 2003 Aug 4;13(15):2485-8.
• [76] Discovery of aminoquinazolines as potent, orally bioavailable inhibitors of Lck: synthesis, SAR, and in vivo anti-inflammatory activity. J Med Chem. 2006 Sep 21;49(19):5671-86.
• [77] Discovery of N-phenyl nicotinamides as potent inhibitors of Kdr. Bioorg Med Chem Lett. 2007 Nov 1;17(21):6003-8.
• [78] The RET kinase inhibitor NVP-AST487 blocks growth and calcitonin gene expression through distinct mechanisms in medullary thyroid cancer cells. Cancer Res. 2007 Jul 15;67(14):6956-64.
• [79] Comprehensive analysis of kinase inhibitor selectivity. Nat Biotechnol. 2011 Oct 30;29(11):1046-51.
• [80] Discovery of a (1H-benzoimidazol-2-yl)-1H-pyridin-2-one (BMS-536924) inhibitor of insulin-like growth factor I receptor kinase with in vivo antitum... J Med Chem. 2005 Sep 8;48(18):5639-43.
• [81] Discovery and preclinical studies of 5-isopropyl-6-(5-methyl-1,3,4-oxadiazol-2-yl)-N-(2-methyl-1H-pyrrolo[2,3-b]pyridin-5-yl)pyrrolo[2,1-f][1,2,4]t... Bioorg Med Chem Lett. 2008 May 1;18(9):2985-9.
• [82] Novel small molecule inhibitors of 3-phosphoinositide-dependent kinase-1. J Biol Chem. 2005 May 20;280(20):19867-74.
• [83] Synthesis of a novel biotin-tagged photoaffinity probe for VEGF receptor tyrosine kinases. Bioorg Med Chem Lett. 2006 Jan 1;16(1):129-33.
• [84] Mixed-lineage kinase 1 and mixed-lineage kinase 3 subtype-selective dihydronaphthyl[3,4-a]pyrrolo[3,4-c]carbazole-5-ones: optimization, mixed-linea... J Med Chem. 2008 Sep 25;51(18):5680-9.
• [85] Identification of substituted 3-[(4,5,6, 7-tetrahydro-1H-indol-2-yl)methylene]-1,3-dihydroindol-2-ones as growth factor receptor inhibitors for VEGF-R2 (Flk-1/KDR), FGF-R1, and PDGF-Rbeta tyrosine kinases. J Med Chem. 2000 Jul 13;43(14):2655-63.
• [86] Isoindolinone ureas: a novel class of KDR kinase inhibitors. Bioorg Med Chem Lett. 2004 Sep 6;14(17):4505-9.
• [87] Synthesis, modeling, and in vitro activity of (3'S)-epi-K-252a analogues. Elucidating the stereochemical requirements of the 3'-sugar alcohol on tr... J Med Chem. 2005 Jun 2;48(11):3776-83.
• [88] A c-fms tyrosine kinase inhibitor, Ki20227, suppresses osteoclast differentiation and osteolytic bone destruction in a bone metastasis model. Mol Cancer Ther. 2006 Nov;5(11):2634-43.
• [89] The design, synthesis, and biological evaluation of potent receptor tyrosine kinase inhibitors. Bioorg Med Chem Lett. 2012 Aug 1;22(15):4979-85.
• [90] Synthesis and structure-activity relationships of a novel and selective bone morphogenetic protein receptor (BMP) inhibitor derived from the pyrazolo[1.5-a]pyrimidine scaffold of dorsomorphin: the discovery of ML347 as an ALK2 versus ALK3 selective MLPCN probe. Bioorg Med Chem Lett. 2013 Jun 1;23(11):3248-52.
• [91] Targeted polypharmacology: discovery of dual inhibitors of tyrosine and phosphoinositide kinases. Nat Chem Biol. 2008 Nov;4(11):691-9.
• [92] Biological evaluation of a multi-targeted small molecule inhibitor of tumor-induced angiogenesis. Bioorg Med Chem Lett. 2006 Apr 1;16(7):1950-3.
• [93] Discovery of 5-[5-fluoro-2-oxo-1,2- dihydroindol-(3Z)-ylidenemethyl]-2,4- dimethyl-1H-pyrrole-3-carboxylic acid (2-diethylaminoethyl)amide, a novel... J Med Chem. 2003 Mar 27;46(7):1116-9.
• [94] Discovery of [7-(2,6-dichlorophenyl)-5-methylbenzo [1,2,4]triazin-3-yl]-[4-(2-pyrrolidin-1-ylethoxy)phenyl]amine--a potent, orally active Src kinas... Bioorg Med Chem Lett. 2007 Feb 1;17(3):602-8.
• [95] Synthesis and biological evaluations of 3-substituted indolin-2-ones: a novel class of tyrosine kinase inhibitors that exhibit selectivity toward particular receptor tyrosine kinases. J Med Chem. 1998 Jul 2;41(14):2588-603.