Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0ETO72)

DOT Name	17-beta-hydroxysteroid dehydrogenase 14 (HSD17B14)
Synonyms	17-beta-HSD 14; EC 1.1.1.62; 17-beta-hydroxysteroid dehydrogenase DHRS10; Dehydrogenase/reductase SDR family member 10; Retinal short-chain dehydrogenase/reductase retSDR3; Short chain dehydrogenase/reductase family 47C member 1
Gene Name	HSD17B14
UniProt ID	DHB14_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	1YDE; 5EN4; 5HS6; 5ICM; 5ICS; 5JS6; 5JSF; 5L7T; 5L7W; 5L7Y; 5O42; 5O43; 5O6O; 5O6X; 5O6Z; 5O72; 5O7C; 6EMM; 6FFB; 6G4L; 6GBT; 6GTB; 6GTU; 6H0M; 6HNO; 6QCK; 6ZDE; 6ZDI; 6ZR6; 6ZRA; 6ZT2
EC Number	1.1.1.62
Pfam ID	PF13561
Sequence	MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFIL CDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYT LTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVN CISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTG IELLVTGGAELGYGCKASRSTPVDAPDIPS
Function	Has NAD-dependent 17-beta-hydroxysteroid dehydrogenase activity. Converts oestradiol to oestrone. The physiological substrate is not known. Acts on oestradiol and 5-androstene-3-beta,17-beta-diol (in vitro).
Tissue Specificity	Highly expressed in brain, placenta, liver and kidney.
Reactome Pathway	Estrogen biosynthesis (R-HSA-193144 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of 17-beta-hydroxysteroid dehydrogenase 14 (HSD17B14).	[1]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of 17-beta-hydroxysteroid dehydrogenase 14 (HSD17B14).	[2]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of 17-beta-hydroxysteroid dehydrogenase 14 (HSD17B14).	[3]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of 17-beta-hydroxysteroid dehydrogenase 14 (HSD17B14).	[4]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of 17-beta-hydroxysteroid dehydrogenase 14 (HSD17B14).	[2]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of 17-beta-hydroxysteroid dehydrogenase 14 (HSD17B14).	[5]
Fluoxetine	DM3PD2C	Approved	Fluoxetine increases the expression of 17-beta-hydroxysteroid dehydrogenase 14 (HSD17B14).	[6]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of 17-beta-hydroxysteroid dehydrogenase 14 (HSD17B14).	[7]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of 17-beta-hydroxysteroid dehydrogenase 14 (HSD17B14).	[9]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of 17-beta-hydroxysteroid dehydrogenase 14 (HSD17B14).	[7]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of 17-beta-hydroxysteroid dehydrogenase 14 (HSD17B14).	[1]
------------------------------------------------------------------------------------


⏷ Show the Full List of 11 Drug(s)

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of 17-beta-hydroxysteroid dehydrogenase 14 (HSD17B14).	[8]
------------------------------------------------------------------------------------

References

1	From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
2	Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
3	Persistent and non-persistent changes in gene expression result from long-term estrogen exposure of MCF-7 breast cancer cells. J Steroid Biochem Mol Biol. 2011 Feb;123(3-5):140-50.
4	Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
5	Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
6	Screening autism-associated environmental factors in differentiating human neural progenitors with fractional factorial design-based transcriptomics. Sci Rep. 2023 Jun 29;13(1):10519. doi: 10.1038/s41598-023-37488-0.
7	Gene expression profiling in Ishikawa cells: a fingerprint for estrogen active compounds. Toxicol Appl Pharmacol. 2009 Apr 1;236(1):85-96.
8	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
9	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.