Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0JWE1B)

• DOT Name: DEP domain-containing protein 1A (DEPDC1)
• Gene Name: DEPDC1
• UniProt ID: DEP1A_HUMAN
• PDB ID: 2YSR
• Pfam ID: PF00610
• Sequence:
  MESQGVPPGPYRATKLWNEVTTSFRAGMPLRKHRQHFKKYGNCFTAGEAVDWLYDLLRNN
  SNFGPEVTRQQTIQLLRKFLKNHVIEDIKGRWGSENVDDNNQLFRFPATSPLKTLPRRYP
  ELRKNNIENFSKDKDSIFKLRNLSRRTPKRHGLHLSQENGEKIKHEIINEDQENAIDNRE
  LSQEDVEEVWRYVILIYLQTILGVPSLEEVINPKQVIPQYIMYNMANTSKRGVVILQNKS
  DDLPHWVLSAMKCLANWPRSNDMNNPTYVGFERDVFRTIADYFLDLPEPLLTFEYYELFV
  NILVVCGYITVSDRSSGIHKIQDDPQSSKFLHLNNLNSFKSTECLLLSLLHREKNKEESD
  STERLQISNPGFQERCAKKMQLVNLRNRRVSANDIMGGSCHNLIGLSNMHDLSSNSKPRC
  CSLEGIVDVPGNSSKEASSVFHQSFPNIEGQNNKLFLESKPKQEFLLNLHSEENIQKPFS
  AGFKRTSTLTVQDQEELCNGKCKSKQLCRSQSLLLRSSTRRNSYINTPVAEIIMKPNVGQ
  GSTSVQTAMESELGESSATINKRLCKSTIELSENSLLPASSMLTGTQSLLQPHLERVAID
  ALQLCCLLLPPPNRRKLQLLMRMISRMSQNVDMPKLHDAMGTRSLMIHTFSRCVLCCAEE
  VDLDELLAGRLVSFLMDHHQEILQVPSYLQTAVEKHLDYLKKGHIENPGDGLFAPLPTYS
  YCKQISAQEFDEQKVSTSQAAIAELLENIIKNRSLPLKEKRKKLKQFQKEYPLIYQKRFP
  TTESEAALFGDKPTIKQPMLILRKPKFRSLR
• Function: May be involved in transcriptional regulation as a transcriptional corepressor. The DEPDC1A-ZNF224 complex may play a critical role in bladder carcinogenesis by repressing the transcription of the A20 gene, leading to transport of NF-KB protein into the nucleus, resulting in suppression of apoptosis of bladder cancer cells.
• Tissue Specificity: Expressed in testis. Up-regulated in bladder cancer cells (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

31 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of DEP domain-containing protein 1A (DEPDC1).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of DEP domain-containing protein 1A (DEPDC1).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of DEP domain-containing protein 1A (DEPDC1).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of DEP domain-containing protein 1A (DEPDC1).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of DEP domain-containing protein 1A (DEPDC1).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of DEP domain-containing protein 1A (DEPDC1).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of DEP domain-containing protein 1A (DEPDC1).	[7]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of DEP domain-containing protein 1A (DEPDC1).	[8]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of DEP domain-containing protein 1A (DEPDC1).	[9]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of DEP domain-containing protein 1A (DEPDC1).	[10]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of DEP domain-containing protein 1A (DEPDC1).	[11]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of DEP domain-containing protein 1A (DEPDC1).	[12]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of DEP domain-containing protein 1A (DEPDC1).	[12]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of DEP domain-containing protein 1A (DEPDC1).	[13]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of DEP domain-containing protein 1A (DEPDC1).	[14]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of DEP domain-containing protein 1A (DEPDC1).	[15]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of DEP domain-containing protein 1A (DEPDC1).	[16]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of DEP domain-containing protein 1A (DEPDC1).	[17]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of DEP domain-containing protein 1A (DEPDC1).	[18]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of DEP domain-containing protein 1A (DEPDC1).	[19]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of DEP domain-containing protein 1A (DEPDC1).	[20]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of DEP domain-containing protein 1A (DEPDC1).	[9]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of DEP domain-containing protein 1A (DEPDC1).	[21]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of DEP domain-containing protein 1A (DEPDC1).	[22]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of DEP domain-containing protein 1A (DEPDC1).	[24]
Nobiletin	DM7R3B6	Preclinical	Nobiletin decreases the expression of DEP domain-containing protein 1A (DEPDC1).	[25]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of DEP domain-containing protein 1A (DEPDC1).	[26]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of DEP domain-containing protein 1A (DEPDC1).	[27]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of DEP domain-containing protein 1A (DEPDC1).	[28]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of DEP domain-containing protein 1A (DEPDC1).	[8]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of DEP domain-containing protein 1A (DEPDC1).	[29]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of DEP domain-containing protein 1A (DEPDC1).	[23]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [8] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [9] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [10] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [11] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [12] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [13] Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
• [14] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [15] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [16] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [17] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [18] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [19] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [20] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [21] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [22] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [23] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [24] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [25] Characteristics of nobiletin-mediated alteration of gene expression in cultured cell lines. Biochem Biophys Res Commun. 2013 Feb 15;431(3):530-4.
• [26] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [27] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [28] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [29] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.