Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1XRDP6)

• DOT Name: Fibulin-7 (FBLN7)
• Synonyms: FIBL-7
• Gene Name: FBLN7
• Related Disease:
  Adult glioblastoma
  Advanced cancer
  Cataract
  Glioblastoma multiforme
• UniProt ID: FBLN7_HUMAN
• Pfam ID: PF00008 ; PF07645 ; PF14670 ; PF00084
• Sequence:
  MVPSSPRALFLLLLILACPEPRASQNCLSKQQLLSAIRQLQQLLKGQETRFAEGIRHMKS
  RLAALQNSVGRVGPDALPVSCPALNTPADGRKFGSKYLVDHEVHFTCNPGFRLVGPSSVV
  CLPNGTWTGEQPHCRGISECSSQPCQNGGTCVEGVNQYRCICPPGRTGNRCQHQAQTAAP
  EGSVAGDSAFSRAPRCAQVERAQHCSCEAGFHLSGAAGDSVCQDVNECELYGQEGRPRLC
  MHACVNTPGSYRCTCPGGYRTLADGKSCEDVDECVGLQPVCPQGTTCINTGGSFQCVSPE
  CPEGSGNVSYVKTSPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKTPITLFRMATA
  SAPGRAGPNSLRFGIVGGNSRGHFVMQRSDRQTGDLILVQNLEGPQTLEVDVDMSEYLDR
  SFQANHVSKVTIFVSPYDF
• Function: An adhesion molecule that interacts with extracellular matrix molecules in developing teeth and may play important roles in differentiation and maintenance of odontoblasts as well as in dentin formation.

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[1]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[1]
Cataract	DISUD7SL	Strong	Altered Expression	[2]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[1]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Fibulin-7 (FBLN7).	[3]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Fibulin-7 (FBLN7).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Fibulin-7 (FBLN7).	[5]
Panobinostat	DM58WKG	Approved	Panobinostat decreases the expression of Fibulin-7 (FBLN7).	[6]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Fibulin-7 (FBLN7).	[6]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of Fibulin-7 (FBLN7).	[6]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Fibulin-7 (FBLN7).	[9]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Fibulin-7 (FBLN7).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Fibulin-7 (FBLN7).	[8]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Fibulin-7 (FBLN7).	[7]

References

• [1] Fibulin-7 is overexpressed in glioblastomas and modulates glioblastoma neovascularization through interaction with angiopoietin-1.Int J Cancer. 2019 Oct 15;145(8):2157-2169. doi: 10.1002/ijc.32306. Epub 2019 Apr 15.
• [2] Spiroplasma eriocheiris Adhesin-Like Protein (ALP) Interacts with Epidermal Growth Factor (EGF) Domain Proteins to Facilitate Infection.Front Cell Infect Microbiol. 2017 Jan 26;7:13. doi: 10.3389/fcimb.2017.00013. eCollection 2017.
• [3] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [4] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [5] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [6] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [7] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [9] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.