General Information of Drug Off-Target (DOT) (ID: OT2SJN0X)

DOT Name Hyaluronidase-1 (HYAL1)
Synonyms Hyal-1; EC 3.2.1.35; Hyaluronoglucosaminidase-1; Lung carcinoma protein 1; LuCa-1
Gene Name HYAL1
Related Disease
Mucopolysaccharidosis type 9 ( )
Small-cell lung cancer ( )
Bladder cancer ( )
Breast carcinoma ( )
Carcinoma ( )
Endometrial carcinoma ( )
Head-neck squamous cell carcinoma ( )
Juvenile idiopathic arthritis ( )
Lung neoplasm ( )
Metastatic prostate carcinoma ( )
Morquio syndrome ( )
Mucopolysaccharidosis ( )
Nasal polyp ( )
Neoplasm ( )
Osteoarthritis ( )
Prostate cancer ( )
Prostate carcinoma ( )
Prostate neoplasm ( )
Pulmonary hypertension ( )
Squamous cell carcinoma ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
Breast cancer ( )
Colorectal carcinoma ( )
Pancreatic cancer ( )
Chronic obstructive pulmonary disease ( )
Epithelial ovarian cancer ( )
Glioma ( )
Lysosomal storage disease ( )
Non-small-cell lung cancer ( )
UniProt ID
HYAL1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2PE4
EC Number
3.2.1.35
Pfam ID
PF01630
Sequence
MAAHLLPICALFLTLLDMAQGFRGPLLPNRPFTTVWNANTQWCLERHGVDVDVSVFDVVA
NPGQTFRGPDMTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAP
DFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQHPDWPAPQVEAVAQDQFQGAAR
AWMAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSR
ALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHFLPL
DELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILNVTSGALLCSQ
ALCSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRC
YPGWQAPWCERKSMW
Function May have a role in promoting tumor progression. May block the TGFB1-enhanced cell growth.
Tissue Specificity
Highly expressed in the liver, kidney and heart. Weakly expressed in lung, placenta and skeletal muscle. No expression detected in adult brain. Isoform 1 is expressed only in bladder and prostate cancer cells, G2/G3 bladder tumor tissues and lymph node specimens showing tumor invasive tumors cells. Isoform 3, isoform 4, isoform 5 and isoform 6 are expressed in normal bladder and bladder tumor tissues.
KEGG Pathway
Glycosaminoglycan degradation (hsa00531 )
Metabolic pathways (hsa01100 )
Lysosome (hsa04142 )
Reactome Pathway
Hyaluronan uptake and degradation (R-HSA-2160916 )
MPS IX - Natowicz syndrome (R-HSA-2206280 )
CS/DS degradation (R-HSA-2024101 )
BioCyc Pathway
MetaCyc:HS03763-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

30 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Mucopolysaccharidosis type 9 DISFSB6J Definitive Autosomal recessive [1]
Small-cell lung cancer DISK3LZD Definitive Altered Expression [2]
Bladder cancer DISUHNM0 Strong Biomarker [3]
Breast carcinoma DIS2UE88 Strong Biomarker [4]
Carcinoma DISH9F1N Strong Altered Expression [5]
Endometrial carcinoma DISXR5CY Strong Altered Expression [6]
Head-neck squamous cell carcinoma DISF7P24 Strong Altered Expression [7]
Juvenile idiopathic arthritis DISQZGBV Strong Biomarker [8]
Lung neoplasm DISVARNB Strong Altered Expression [9]
Metastatic prostate carcinoma DISVBEZ9 Strong Biomarker [10]
Morquio syndrome DIS2Y2P2 Strong Altered Expression [11]
Mucopolysaccharidosis DISB083T Strong Biomarker [12]
Nasal polyp DISLP3XE Strong Biomarker [13]
Neoplasm DISZKGEW Strong Biomarker [14]
Osteoarthritis DIS05URM Strong Biomarker [12]
Prostate cancer DISF190Y Strong Biomarker [14]
Prostate carcinoma DISMJPLE Strong Biomarker [14]
Prostate neoplasm DISHDKGQ Strong Biomarker [14]
Pulmonary hypertension DIS1RSP5 Strong Biomarker [15]
Squamous cell carcinoma DISQVIFL Strong Altered Expression [16]
Urinary bladder cancer DISDV4T7 Strong Biomarker [3]
Urinary bladder neoplasm DIS7HACE Strong Biomarker [3]
Breast cancer DIS7DPX1 moderate Biomarker [4]
Colorectal carcinoma DIS5PYL0 moderate Biomarker [17]
Pancreatic cancer DISJC981 moderate Biomarker [18]
Chronic obstructive pulmonary disease DISQCIRF Limited Altered Expression [19]
Epithelial ovarian cancer DIS56MH2 Limited Altered Expression [20]
Glioma DIS5RPEH Limited Altered Expression [2]
Lysosomal storage disease DIS6QM6U Limited Genetic Variation [21]
Non-small-cell lung cancer DIS5Y6R9 Limited Altered Expression [22]
------------------------------------------------------------------------------------
⏷ Show the Full List of 30 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Dactinomycin DM2YGNW Approved Hyaluronidase-1 (HYAL1) increases the Cell-mediated cytotoxicity ADR of Dactinomycin. [38]
------------------------------------------------------------------------------------
14 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Hyaluronidase-1 (HYAL1). [23]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Hyaluronidase-1 (HYAL1). [24]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Hyaluronidase-1 (HYAL1). [25]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Hyaluronidase-1 (HYAL1). [26]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Hyaluronidase-1 (HYAL1). [27]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Hyaluronidase-1 (HYAL1). [29]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Hyaluronidase-1 (HYAL1). [28]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of Hyaluronidase-1 (HYAL1). [30]
Folic acid DMEMBJC Approved Folic acid increases the expression of Hyaluronidase-1 (HYAL1). [31]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Hyaluronidase-1 (HYAL1). [32]
DNCB DMDTVYC Phase 2 DNCB increases the expression of Hyaluronidase-1 (HYAL1). [33]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Hyaluronidase-1 (HYAL1). [35]
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the expression of Hyaluronidase-1 (HYAL1). [36]
PP-242 DM2348V Investigative PP-242 decreases the expression of Hyaluronidase-1 (HYAL1). [37]
------------------------------------------------------------------------------------
⏷ Show the Full List of 14 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic decreases the methylation of Hyaluronidase-1 (HYAL1). [28]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Hyaluronidase-1 (HYAL1). [34]
------------------------------------------------------------------------------------

References

1 Clinical and biochemical manifestations of hyaluronidase deficiency. N Engl J Med. 1996 Oct 3;335(14):1029-33. doi: 10.1056/NEJM199610033351405.
2 Expression and regulation patterns of hyaluronidases in small cell lung cancer and glioma lines.Oncol Rep. 2003 May-Jun;10(3):609-16.
3 Antitumor activity of sulfated hyaluronic acid fragments in pre-clinical models of bladder cancer.Oncotarget. 2017 Apr 11;8(15):24262-24274. doi: 10.18632/oncotarget.10529.
4 Role of HYAL1 expression in primary breast cancer in the formation of brain metastases.Breast Cancer Res Treat. 2017 Apr;162(3):427-438. doi: 10.1007/s10549-017-4135-6. Epub 2017 Feb 6.
5 Hyaluronan synthase and hyaluronidase expression in serous ovarian carcinoma is related to anatomic site and chemotherapy exposure.Int J Mol Sci. 2012 Oct 10;13(10):12925-38. doi: 10.3390/ijms131012925.
6 Expression patterns of hyaluronan, hyaluronan synthases and hyaluronidases indicate a role for hyaluronan in the progression of endometrial cancer.Gynecol Oncol. 2005 Aug;98(2):193-202. doi: 10.1016/j.ygyno.2005.02.031.
7 Expression of tumor markers hyaluronic acid and hyaluronidase (HYAL1) in head and neck tumors.Int J Cancer. 2003 Sep 1;106(3):438-45. doi: 10.1002/ijc.11252.
8 A complete deficiency of Hyaluronoglucosaminidase 1 (HYAL1) presenting as familial juvenile idiopathic arthritis.J Inherit Metab Dis. 2011 Oct;34(5):1013-22. doi: 10.1007/s10545-011-9343-3. Epub 2011 May 11.
9 [Down-regulation of RBSP3/CTDSPL, NPRL2/G21, RASSF1A, ITGA9, HYAL1 and HYAL2 genes in non-small cell lung cancer].Mol Biol (Mosk). 2008 Nov-Dec;42(6):965-76.
10 Hyaluronidase expression induces prostate tumor metastasis in an orthotopic mouse model.Am J Pathol. 2006 Oct;169(4):1415-26. doi: 10.2353/ajpath.2006.060324.
11 Serum hyaluronidase aberrations in metabolic and morphogenetic disorders.Glycoconj J. 2005 Nov;22(7-9):395-400. doi: 10.1007/s10719-005-1390-2.
12 Conditional knockdown of hyaluronidase 2 in articular cartilage stimulates osteoarthritic progression in a mice model.Sci Rep. 2017 Aug 1;7(1):7028. doi: 10.1038/s41598-017-07376-5.
13 Hyaluronan synthases and hyaluronidases in nasal polyps.Eur Arch Otorhinolaryngol. 2016 Jul;273(7):1801-8. doi: 10.1007/s00405-015-3848-6. Epub 2015 Dec 10.
14 Prostate tumor cell exosomes containing hyaluronidase Hyal1 stimulate prostate stromal cell motility by engagement of FAK-mediated integrin signaling.Matrix Biol. 2019 May;78-79:165-179. doi: 10.1016/j.matbio.2018.05.002. Epub 2018 May 10.
15 The enzymatic degradation of hyaluronan is associated with disease progression in experimental pulmonary hypertension.Am J Physiol Lung Cell Mol Physiol. 2010 Feb;298(2):L148-57. doi: 10.1152/ajplung.00097.2009. Epub 2009 Nov 13.
16 The investigation of hyaluronic acid and hyaluronidase-1 levels as tumour marker in larynx cancer.Clin Otolaryngol. 2019 Nov;44(6):914-918. doi: 10.1111/coa.13390. Epub 2019 Aug 1.
17 The suppressive role of HYAL1 and HYAL2 in the metastasis of colorectal cancer.J Gastroenterol Hepatol. 2019 Oct;34(10):1766-1776. doi: 10.1111/jgh.14660. Epub 2019 Apr 10.
18 High-molecular-weight hyaluronan produced by activated pancreatic stellate cells promotes pancreatic cancer cell migration via paracrine signaling.Biochem Biophys Res Commun. 2019 Jul 30;515(3):493-498. doi: 10.1016/j.bbrc.2019.05.167. Epub 2019 Jun 3.
19 Serum levels of hyaluronic acid are associated with COPD severity and predict survival.Eur Respir J. 2019 Mar 7;53(3):1801183. doi: 10.1183/13993003.01183-2018. Print 2019 Mar.
20 Subtype specific elevated expression of hyaluronidase-1 (HYAL-1) in epithelial ovarian cancer.PLoS One. 2011;6(6):e20705. doi: 10.1371/journal.pone.0020705. Epub 2011 Jun 10.
21 A mouse model of human mucopolysaccharidosis IX exhibits osteoarthritis.Hum Mol Genet. 2008 Jul 1;17(13):1904-15. doi: 10.1093/hmg/ddn088. Epub 2008 Mar 15.
22 The 630-kb lung cancer homozygous deletion region on human chromosome 3p21.3: identification and evaluation of the resident candidate tumor suppressor genes. The International Lung Cancer Chromosome 3p21.3 Tumor Suppressor Gene Consortium.Cancer Res. 2000 Nov 1;60(21):6116-33.
23 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
24 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
25 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
26 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
27 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
28 Differential DNA methylation profile of key genes in malignant prostate epithelial cells transformed by inorganic arsenic or cadmium. Toxicol Appl Pharmacol. 2015 Aug 1;286(3):159-67.
29 Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
30 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
31 Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
32 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
33 Contact allergen (PPD and DNCB)-induced keratinocyte sensitization is partly mediated through a low molecular weight hyaluronan (LMWHA)/TLR4/NF-B signaling axis. Toxicol Appl Pharmacol. 2019 Aug 15;377:114632. doi: 10.1016/j.taap.2019.114632. Epub 2019 Jun 19.
34 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
35 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
36 Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
37 Marine biogenics in sea spray aerosols interact with the mTOR signaling pathway. Sci Rep. 2019 Jan 24;9(1):675.
38 ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.