Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3Q6UIM)

DOT Name Probable RNA-binding protein 19 (RBM19)
Synonyms RNA-binding motif protein 19
Gene Name RBM19
Related Disease
Cervical cancer ( )
Cervical carcinoma ( )
Childhood acute lymphoblastic leukemia ( )
Hepatocellular carcinoma ( )
Non-insulin dependent diabetes ( )
Non-small-cell lung cancer ( )
Ptosis ( )
Intellectual disability, autosomal dominant 1 ( )
Graft-versus-host disease ( )
Parkinson disease ( )
UniProt ID
RBM19_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2DGW
Pfam ID
PF00076
Sequence
MSRLIVKNLPNGMKEERFRQLFAAFGTLTDCSLKFTKDGKFRKFGFIGFKSEEEAQKAQK
HFNKSFIDTSRITVEFCKSFGDPAKPRAWSKHAQKPSQPKQPPKDSTTPEIKKDEKKKKV
AGQLEKLKEDTEFQEFLSVHQRRAQAATWANDGLDAEPSKGKSKPASDYLNFDSDSGQES
EEEGAGEDLEEEASLEPKAAVQKELSDMDYLKSKMVKAGSSSSSEEEESEDEAVHCDEGS
EAEEEDSSATPVLQERDSKGAGQEQGMPAGKKRPPEARAETEKPANQKEPTTCHTVKLRG
APFNVTEKNVMEFLAPLKPVAIRIVRNAHGNKTGYIFVDFSNEEEVKQALKCNREYMGGR
YIEVFREKNVPTTKGAPKNTTKSWQGRILGENEEEEDLAESGRLFVRNLPYTSTEEDLEK
LFSKYGPLSELHYPIDSLTKKPKGFAFITFMFPEHAVKAYSEVDGQVFQGRMLHVLPSTI
KKEASEDASALGSSSYKKKKEAQDKANSASSHNWNTLFMGPNAVADAIAQKYNATKSQVF
DHETKGSVAVRVALGETQLVQEVRRFLIDNGVSLDSFSQAAAERSKTVILVKNLPAGTLA
AQLQETFGHFGSLGRVLLPEGGITAIVEFLEPLEARKAFRHLAYSKFHHVPLYLEWAPVG
VFSSTAPQKKKLQDTPSEPMEKDPAEPETVPDGETPEDENPTEEGADNSSAKMEEEEEEE
EEEEESLPGCTLFIKNLNFDTTEEKLKEVFSKVGTVKSCSISKKKNKAGVLLSMGFGFVE
YRKPEQAQKALKQLQGHVVDGHKLEVRISERATKPAVTLARKKQVPRKQTTSKILVRNIP
FQAHSREIRELFSTFGELKTVRLPKKMTGTGTHRGFGFVDFLTKQDAKRAFNALCHSTHL
YGRRLVLEWADSEVTLQALRRKTAAHFHEPPKKKRSVVLDEILEQLEGSDSDSEEQTLQL
Function Plays a role in embryo pre-implantation development.
Tissue Specificity Expressed in the crypts of Lieberkuhn of the intestine and in intestinal neoplasia (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

10 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Cervical cancer DISFSHPF Strong Altered Expression [1]
Cervical carcinoma DIST4S00 Strong Altered Expression [1]
Childhood acute lymphoblastic leukemia DISJ5D6U Strong Genetic Variation [2]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [3]
Non-insulin dependent diabetes DISK1O5Z Strong Genetic Variation [4]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [5]
Ptosis DISJZNIY moderate Biomarker [6]
Intellectual disability, autosomal dominant 1 DISPIV05 Disputed Biomarker [7]
Graft-versus-host disease DIS0QADF Limited Biomarker [8]
Parkinson disease DISQVHKL Limited Genetic Variation [9]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 2 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Temozolomide DMKECZD Approved Probable RNA-binding protein 19 (RBM19) affects the response to substance of Temozolomide. [22]
DTI-015 DMXZRW0 Approved Probable RNA-binding protein 19 (RBM19) affects the response to substance of DTI-015. [22]
------------------------------------------------------------------------------------
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Probable RNA-binding protein 19 (RBM19). [10]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Probable RNA-binding protein 19 (RBM19). [11]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Probable RNA-binding protein 19 (RBM19). [12]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Probable RNA-binding protein 19 (RBM19). [13]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Probable RNA-binding protein 19 (RBM19). [14]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Probable RNA-binding protein 19 (RBM19). [15]
Quercetin DM3NC4M Approved Quercetin increases the expression of Probable RNA-binding protein 19 (RBM19). [17]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Probable RNA-binding protein 19 (RBM19). [19]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Probable RNA-binding protein 19 (RBM19). [16]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Probable RNA-binding protein 19 (RBM19). [18]
TAK-243 DM4GKV2 Phase 1 TAK-243 decreases the sumoylation of Probable RNA-binding protein 19 (RBM19). [20]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Probable RNA-binding protein 19 (RBM19). [21]
------------------------------------------------------------------------------------

References

1 Expression levels of resistant genes affect cervical cancer prognosis.Mol Med Rep. 2017 May;15(5):2802-2806. doi: 10.3892/mmr.2017.6328. Epub 2017 Mar 15.
2 Minimal residual disease-guided treatment deintensification for children with acute lymphoblastic leukemia: results from the Malaysia-Singapore acute lymphoblastic leukemia 2003 study.J Clin Oncol. 2012 Jul 1;30(19):2384-92. doi: 10.1200/JCO.2011.40.5936. Epub 2012 May 21.
3 Human hepatocellular carcinoma cell lines exhibit multidrug resistance unrelated to MRD1 gene expression.J Cell Sci. 1991 Mar;98 ( Pt 3):317-22. doi: 10.1242/jcs.98.3.317.
4 Genetic Variants in HSD17B3, SMAD3, and IPO11 Impact Circulating Lipids in Response to Fenofibrate in Individuals With Type 2 Diabetes.Clin Pharmacol Ther. 2018 Apr;103(4):712-721. doi: 10.1002/cpt.798. Epub 2017 Nov 3.
5 SNHG7 mediates cisplatin-resistance in non-small cell lung cancer by activating PI3K/AKT pathway.Eur Rev Med Pharmacol Sci. 2019 Aug;23(16):6935-6943. doi: 10.26355/eurrev_201908_18733.
6 Surgical Predictors of Reduced Marginal Reflex Distance After Upper Blepharoplasty.Ophthalmic Plast Reconstr Surg. 2019 Nov/Dec;35(6):566-568. doi: 10.1097/IOP.0000000000001376.
7 Major impact of an early bone marrow checkpoint (day 21) for minimal residual disease in flow cytometry in childhood acute lymphoblastic leukemia.Hematol Oncol. 2017 Jun;35(2):237-243. doi: 10.1002/hon.2263. Epub 2015 Oct 9.
8 Eyelid metrics assessment in patients with chronic ocular graft versus-host disease.Ocul Surf. 2019 Jan;17(1):98-103. doi: 10.1016/j.jtos.2018.10.005. Epub 2018 Oct 12.
9 Association between MDR1 gene polymorphisms and Parkinson's disease in Asian and Caucasian populations: a meta-analysis.J Neurol Sci. 2016 Sep 15;368:255-62. doi: 10.1016/j.jns.2016.07.041. Epub 2016 Jul 18.
10 Antiepileptic drugs are endocrine disruptors for the human fetal testis ex vivo. Toxicol Sci. 2023 Sep 28;195(2):169-183. doi: 10.1093/toxsci/kfad076.
11 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
12 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
13 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
14 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
15 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
16 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
17 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
18 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
19 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
20 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
21 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
22 Tumor necrosis factor-alpha-induced protein 3 as a putative regulator of nuclear factor-kappaB-mediated resistance to O6-alkylating agents in human glioblastomas. J Clin Oncol. 2006 Jan 10;24(2):274-87. doi: 10.1200/JCO.2005.02.9405. Epub 2005 Dec 19.