General Information of Drug Off-Target (DOT) (ID: OT404F9K)

DOT Name Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5)
Synonyms
PPIase FKBP5; EC 5.2.1.8; 51 kDa FK506-binding protein; 51 kDa FKBP; FKBP-51; 54 kDa progesterone receptor-associated immunophilin; Androgen-regulated protein 6; FF1 antigen; FK506-binding protein 5; FKBP-5; FKBP54; p54; HSP90-binding immunophilin; Rotamase
Gene Name FKBP5
UniProt ID
FKBP5_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1KT0 ; 3O5D ; 3O5E ; 3O5F ; 3O5G ; 3O5I ; 3O5J ; 3O5K ; 3O5L ; 3O5M ; 3O5O ; 3O5P ; 3O5Q ; 3O5R ; 4DRH ; 4DRI ; 4DRK ; 4DRM ; 4DRN ; 4DRO ; 4DRP ; 4DRQ ; 4JFI ; 4JFJ ; 4JFK ; 4JFL ; 4JFM ; 4R0X ; 4TW6 ; 4TW7 ; 4TX0 ; 4W9O ; 4W9P ; 4W9Q ; 5BXJ ; 5DIT ; 5DIU ; 5DIV ; 5NJX ; 5OBK ; 5OMP ; 6SAF ; 6TX4 ; 6TX5 ; 6TX6 ; 6TX7 ; 6TX8 ; 6TX9 ; 6TXX ; 7A6W ; 7A6X ; 7AOT ; 7AOU ; 7APQ ; 7APS ; 7APT ; 7APW ; 7AWF ; 7AWX ; 7B9Y ; 7B9Z ; 7BA0 ; 7ETT ; 7ETU ; 7ETV ; 7L7I ; 7R0L ; 8BA6 ; 8BAJ ; 8CCA ; 8CCB ; 8CCC ; 8CCD ; 8CCE ; 8CCF ; 8CCG ; 8CCH ; 8CHN ; 8CHP ; 8CHQ ; 8CHR ; 8FFW ; 8PC2
EC Number
5.2.1.8
Pfam ID
PF00254 ; PF00515 ; PF13174
Sequence
MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGK
LSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLP
KIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRM
FDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAE
LIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEM
EYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEA
QLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQD
AKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV
Function
Immunophilin protein with PPIase and co-chaperone activities. Component of unligated steroid receptors heterocomplexes through interaction with heat-shock protein 90 (HSP90). Plays a role in the intracellular trafficking of heterooligomeric forms of steroid hormone receptors maintaining the complex into the cytoplasm when unliganded. Acts as a regulator of Akt/AKT1 activity by promoting the interaction between Akt/AKT1 and PHLPP1, thereby enhancing dephosphorylation and subsequent activation of Akt/AKT1. Interacts with IKBKE and IKBKB which facilitates IKK complex assembly leading to increased IKBKE and IKBKB kinase activity, NF-kappaB activation, and IFN production.
Tissue Specificity Widely expressed, enriched in testis compared to other tissues.
KEGG Pathway
Estrogen sig.ling pathway (hsa04915 )
Reactome Pathway
ESR-mediated signaling (R-HSA-8939211 )
MECP2 regulates neuronal receptors and channels (R-HSA-9022699 )
HSP90 chaperone cycle for steroid hormone receptors (SHR) in the presence of ligand (R-HSA-3371497 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
36 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [3]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [6]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [7]
Arsenic DMTL2Y1 Approved Arsenic decreases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [8]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide affects the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [9]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [10]
Testosterone DM7HUNW Approved Testosterone increases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [10]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [11]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [12]
Progesterone DMUY35B Approved Progesterone increases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [13]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [14]
Niclosamide DMJAGXQ Approved Niclosamide decreases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [15]
Bortezomib DMNO38U Approved Bortezomib decreases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [16]
Testosterone enanthate DMB6871 Approved Testosterone enanthate affects the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [17]
Amphotericin B DMTAJQE Approved Amphotericin B decreases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [18]
Bicalutamide DMZMSPF Approved Bicalutamide decreases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [15]
Enzalutamide DMGL19D Approved Enzalutamide decreases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [19]
Hydrocortisone DMGEMB7 Approved Hydrocortisone increases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [20]
Nefazodone DM4ZS8M Approved Nefazodone decreases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [21]
Atazanavir DMSYRBX Approved Atazanavir decreases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [21]
Atenolol DMNKG1Z Approved Atenolol decreases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [22]
Tibolone DM78XFG Approved Tibolone increases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [23]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [24]
Dihydrotestosterone DM3S8XC Phase 4 Dihydrotestosterone increases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [25]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [26]
Tamibarotene DM3G74J Phase 3 Tamibarotene decreases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [3]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate increases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [27]
ACYLINE DM9GRTK Phase 2 ACYLINE decreases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [28]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [25]
Coumestrol DM40TBU Investigative Coumestrol increases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [31]
[3H]methyltrienolone DMTSGOW Investigative [3H]methyltrienolone increases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [33]
AHPN DM8G6O4 Investigative AHPN decreases the expression of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [34]
------------------------------------------------------------------------------------
⏷ Show the Full List of 36 Drug(s)
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [29]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 increases the phosphorylation of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [30]
Hexadecanoic acid DMWUXDZ Investigative Hexadecanoic acid decreases the phosphorylation of Peptidyl-prolyl cis-trans isomerase FKBP5 (FKBP5). [32]
------------------------------------------------------------------------------------

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
4 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
8 Inorganic arsenic promotes luminal to basal transition and metastasis of breast cancer. FASEB J. 2020 Dec;34(12):16034-16048. doi: 10.1096/fj.202001192R. Epub 2020 Oct 13.
9 Evaluation of gene expression changes in human primary lung epithelial cells following 24-hr exposures to inorganic arsenic and its methylated metabolites and to arsenic trioxide. Environ Mol Mutagen. 2015 Jun;56(5):477-90. doi: 10.1002/em.21937. Epub 2015 Apr 14.
10 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
11 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
12 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
13 Progesterone regulation of implantation-related genes: new insights into the role of oestrogen. Cell Mol Life Sci. 2007 Apr;64(7-8):1009-32.
14 Glucocorticoid regulation of human eosinophil gene expression. J Steroid Biochem Mol Biol. 2003 Mar;84(4):441-52. doi: 10.1016/s0960-0760(03)00065-7.
15 Niclosamide and Bicalutamide Combination Treatment Overcomes Enzalutamide- and Bicalutamide-Resistant Prostate Cancer. Mol Cancer Ther. 2017 Aug;16(8):1521-1530. doi: 10.1158/1535-7163.MCT-16-0912. Epub 2017 May 12.
16 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
17 Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
18 Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
19 Inhibition of the erythropoietin-producing receptor EPHB4 antagonizes androgen receptor overexpression and reduces enzalutamide resistance. J Biol Chem. 2020 Apr 17;295(16):5470-5483. doi: 10.1074/jbc.RA119.011385. Epub 2020 Mar 17.
20 Ultradian cortisol pulsatility encodes a distinct, biologically important signal. PLoS One. 2011 Jan 18;6(1):e15766.
21 Robustness testing and optimization of an adverse outcome pathway on cholestatic liver injury. Arch Toxicol. 2020 Apr;94(4):1151-1172. doi: 10.1007/s00204-020-02691-9. Epub 2020 Mar 10.
22 Change in mRNA Expression after Atenolol, a Beta-adrenergic Receptor Antagonist and Association with Pharmacological Response. Arch Drug Inf. 2009 Sep;2(3):41-50. doi: 10.1111/j.1753-5174.2009.00020.x.
23 A microarray study on the effect of four hormone therapy regimens on gene transcription in whole blood from healthy postmenopausal women. Thromb Res. 2012 Jul;130(1):45-51. doi: 10.1016/j.thromres.2011.12.009. Epub 2012 Jan 2.
24 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
25 Unique bisphenol A transcriptome in prostate cancer: novel effects on ERbeta expression that correspond to androgen receptor mutation status. Environ Health Perspect. 2007 Nov;115(11):1646-53. doi: 10.1289/ehp.10283.
26 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
27 Depletion of the cellular levels of Bag-1 proteins attenuates phorbol ester-induced downregulation of IB and nuclear accumulation of NF-B. Biochem Biophys Res Commun. 2010 Oct 22;401(3):406-11. doi: 10.1016/j.bbrc.2010.09.067. Epub 2010 Sep 19.
28 Intraprostatic androgens and androgen-regulated gene expression persist after testosterone suppression: therapeutic implications for castration-resistant prostate cancer. Cancer Res. 2007 May 15;67(10):5033-41.
29 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
30 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
31 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
32 Functional lipidomics: Palmitic acid impairs hepatocellular carcinoma development by modulating membrane fluidity and glucose metabolism. Hepatology. 2017 Aug;66(2):432-448. doi: 10.1002/hep.29033. Epub 2017 Jun 16.
33 Identification of genes targeted by the androgen and PKA signaling pathways in prostate cancer cells. Oncogene. 2006 Nov 23;25(55):7311-23.
34 ST1926, a novel and orally active retinoid-related molecule inducing apoptosis in myeloid leukemia cells: modulation of intracellular calcium homeostasis. Blood. 2004 Jan 1;103(1):194-207.