Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6UQV2K)

• DOT Name: Insulin-like growth factor-binding protein 1 (IGFBP1)
• Synonyms: IBP-1; IGF-binding protein 1; IGFBP-1; Placental protein 12; PP12
• Gene Name: IGFBP1
• UniProt ID: IBP1_HUMAN
• PDB ID: 1ZT3; 1ZT5; 2DSQ
• Pfam ID: PF00219 ; PF00086
• Sequence:
  MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCC
  PMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGS
  PESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIEL
  YRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIP
  GSPEIRGDPNCQIYFNVQN
• Function: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration.
• Reactome Pathway:
  Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426)
  Post-translational protein phosphorylation (R-HSA-8957275)
  FOXO-mediated transcription of oxidative stress, metabolic and neuronal genes (R-HSA-9615017)
  ATF4 activates genes in response to endoplasmic reticulum stress (R-HSA-380994)

Molecular Interaction Atlas (MIA) of This DOT

40 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[1]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[4]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[5]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[6]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[7]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[7]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[8]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[9]
Phenobarbital	DMXZOCG	Approved	Phenobarbital increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[10]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[11]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[5]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[12]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[9]
Clozapine	DMFC71L	Approved	Clozapine increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[13]
Azacitidine	DMTA5OE	Approved	Azacitidine increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[14]
Deoxycholic acid	DM3GYAL	Approved	Deoxycholic acid decreases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[15]
Tetracycline	DMZA017	Approved	Tetracycline increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[15]
Clotrimazole	DMMFCIH	Approved	Clotrimazole increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[10]
Vandetanib	DMRICNP	Approved	Vandetanib increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[16]
L-tryptophan	DMIBH7M	Approved	L-tryptophan increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[17]
Tianeptine	DMYN8MA	Approved	Tianeptine increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[15]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[18]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[19]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[20]
Chlorpromazine	DMBGZI3	Phase 3 Trial	Chlorpromazine increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[21]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[15]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[20]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[23]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[2]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[24]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[25]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[26]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[6]
Forskolin	DM6ITNG	Investigative	Forskolin increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[27]
Hydroxyestradiol	DMJXQME	Investigative	Hydroxyestradiol increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[17]
Nicotinamide-Adenine-Dinucleotide	DM9LRKB	Investigative	Nicotinamide-Adenine-Dinucleotide increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[17]
2-hydroxy-17beta-estradiol	DMM9Z0B	Investigative	2-hydroxy-17beta-estradiol increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[17]
Lisinopril	DMUOK4C	Investigative	Lisinopril increases the expression of Insulin-like growth factor-binding protein 1 (IGFBP1).	[28]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Insulin-like growth factor-binding protein 1 (IGFBP1).	[22]

References

• [1] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [2] Gene expression changes associated with cytotoxicity identified using cDNA arrays. Funct Integr Genomics. 2000 Sep;1(2):114-26.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Arsenite and cadmium promote the development of mammary tumors. Carcinogenesis. 2020 Jul 14;41(7):1005-1014. doi: 10.1093/carcin/bgz176.
• [6] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [7] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [8] Triclosan and bisphenol a affect decidualization of human endometrial stromal cells. Mol Cell Endocrinol. 2016 Feb 15;422:74-83. doi: 10.1016/j.mce.2015.11.017. Epub 2015 Nov 19.
• [9] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [10] Troglitazone stimulates IGF-binding protein-1 by a PPAR gamma-independent mechanism. Biochem Biophys Res Commun. 2003 Apr 4;303(2):693-9. doi: 10.1016/s0006-291x(03)00403-0.
• [11] Progesterone regulation of implantation-related genes: new insights into the role of oestrogen. Cell Mol Life Sci. 2007 Apr;64(7-8):1009-32.
• [12] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
• [13] Toxicoproteomics reveals an effect of clozapine on autophagy in human liver spheroids. Toxicol Mech Methods. 2023 Jun;33(5):401-410. doi: 10.1080/15376516.2022.2156005. Epub 2022 Dec 19.
• [14] The effect of DNA methylation inhibitor 5-Aza-2'-deoxycytidine on human endometrial stromal cells. Hum Reprod. 2010 Nov;25(11):2859-69.
• [15] Advantageous use of HepaRG cells for the screening and mechanistic study of drug-induced steatosis. Toxicol Appl Pharmacol. 2016 Jul 1;302:1-9. doi: 10.1016/j.taap.2016.04.007. Epub 2016 Apr 16.
• [16] ZD6474 inhibits tumor growth and intraperitoneal dissemination in a highly metastatic orthotopic gastric cancer model. Int J Cancer. 2006 Jan 15;118(2):483-9. doi: 10.1002/ijc.21340.
• [17] Tryptophan and kynurenine stimulate human decidualization via activating Aryl hydrocarbon receptor: Short title: Kynurenine action on human decidualization. Reprod Toxicol. 2020 Sep;96:282-292. doi: 10.1016/j.reprotox.2020.07.011. Epub 2020 Aug 8.
• [18] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [19] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [20] Gene expression profiles with activation of the estrogen receptor alpha-selective estrogen receptor modulator complex in breast cancer cells expressing wild-type estrogen receptor. Cancer Res. 2002 Aug 1;62(15):4419-26.
• [21] Effects of chlorpromazine with and without UV irradiation on gene expression of HepG2 cells. Mutat Res. 2005 Aug 4;575(1-2):47-60. doi: 10.1016/j.mrfmmm.2005.03.002. Epub 2005 Apr 26.
• [22] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [23] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [24] Effect of bisphenol A on human endometrial stromal fibroblasts in vitro. Reprod Biomed Online. 2011 Mar;22(3):249-56.
• [25] Ochratoxin a lowers mRNA levels of genes encoding for key proteins of liver cell metabolism. Cancer Genomics Proteomics. 2008 Nov-Dec;5(6):319-32.
• [26] Effects of nickel treatment on H3K4 trimethylation and gene expression. PLoS One. 2011 Mar 24;6(3):e17728. doi: 10.1371/journal.pone.0017728.
• [27] Different mechanisms for the induction of copper-zinc superoxide dismutase and manganese superoxide dismutase by progesterone in human endometrial stromal cells. Hum Reprod. 2002 Jul;17(7):1709-14. doi: 10.1093/humrep/17.7.1709.
• [28] Tissue availability of insulin-like growth factor I is inversely related to insulin resistance in essential hypertension: effects of angiotensin converting enzyme inhibition. J Hypertens. 1998 Jun;16(6):863-70. doi: 10.1097/00004872-199816060-00018.