Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6XS67M)

DOT Name Lysozyme-like protein 6 (LYZL6)
Synonyms EC 3.2.1.17
Gene Name LYZL6
UniProt ID
LYZL6_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
3.2.1.17
Pfam ID
PF00062
Sequence
MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNIS
KINENADGSFDYGLFQINSHYWCNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGA
RGMNNWVEWRLHCSGRPLFYWLTGCRLR
Function
May be involved sperm-egg plasma membrane adhesion and fusion during fertilization. Exhibits bacteriolytic activity in vitro against Micrococcus luteus and Staphylococcus aureus. Shows weak bacteriolytic activity against Gram-positive bacteria at physiological pH. Bacteriolytic activity is pH-dependent, with a maximum at around pH 5.6.
Tissue Specificity Expressed in testis, epididymis and spermatozoa (at protein level) . Expressed in late-stage spermatocytes and round spermatids .

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Lysozyme-like protein 6 (LYZL6). [1]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Lysozyme-like protein 6 (LYZL6). [2]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Lysozyme-like protein 6 (LYZL6). [3]
Panobinostat DM58WKG Approved Panobinostat increases the expression of Lysozyme-like protein 6 (LYZL6). [1]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Lysozyme-like protein 6 (LYZL6). [1]
Belinostat DM6OC53 Phase 2 Belinostat increases the expression of Lysozyme-like protein 6 (LYZL6). [1]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Lysozyme-like protein 6 (LYZL6). [3]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
2 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.