Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT714BUO)

• DOT Name: Aldehyde dehydrogenase family 3 member A2 (ALDH3A2)
• Synonyms: EC 1.2.1.3; EC 1.2.1.94; Aldehyde dehydrogenase 10; Fatty aldehyde dehydrogenase; Microsomal aldehyde dehydrogenase
• Gene Name: ALDH3A2
• Related Disease: Sjogren-Larsson syndrome
• UniProt ID: AL3A2_HUMAN
• PDB ID: 4QGK
• EC Number: 1.2.1.3; 1.2.1.94
• Pfam ID: PF00171
• Sequence:
  MELEVRRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILTAIAADLCKSEFNVYSQE
  VITVLGEIDFMLENLPEWVTAKPVKKNVLTMLDEAYIQPQPLGVVLIIGAWNYPFVLTIQ
  PLIGAIAAGNAVIIKPSELSENTAKILAKLLPQYLDQDLYIVINGGVEETTELLKQRFDH
  IFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRRITWGKYMNCGQT
  CIAPDYILCEASLQNQIVWKIKETVKEFYGENIKESPDYERIINLRHFKRILSLLEGQKI
  AFGGETDEATRYIAPTVLTDVDPKTKVMQEEIFGPILPIVPVKNVDEAINFINEREKPLA
  LYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFS
  HQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKEKLGLLLLTFLGIVAAVLV
  KAEYY
• Function: Catalyzes the oxidation of medium and long chain aliphatic aldehydes to fatty acids. Active on a variety of saturated and unsaturated aliphatic aldehydes between 6 and 24 carbons in length. Responsible for conversion of the sphingosine 1-phosphate (S1P) degradation product hexadecenal to hexadecenoic acid.
• Tissue Specificity: Detected in liver (at protein level).
• KEGG Pathway:
  Glycolysis / Gluconeogenesis (hsa00010)
  Ascorbate and aldarate metabolism (hsa00053)
  Fatty acid degradation (hsa00071)
  Valine, leucine and isoleucine degradation (hsa00280)
  Lysine degradation (hsa00310)
  Arginine and proline metabolism (hsa00330)
  Histidine metabolism (hsa00340)
  Tryptophan metabolism (hsa00380)
  beta-Alanine metabolism (hsa00410)
  Glycerolipid metabolism (hsa00561)
  Pyruvate metabolism (hsa00620)
  Pantothe.te and CoA biosynthesis (hsa00770)
  Metabolic pathways (hsa01100)
  Biosynthesis of cofactors (hsa01240)
  Alcoholic liver disease (hsa04936)
• Reactome Pathway:
  RND1 GTPase cycle (R-HSA-9696273)
  RND2 GTPase cycle (R-HSA-9696270)
• BioCyc Pathway: MetaCyc:HS01061-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Sjogren-Larsson syndrome	DISP943Y	Definitive	Autosomal recessive	[1]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	Aldehyde dehydrogenase family 3 member A2 (ALDH3A2) affects the response to substance of Fluorouracil.	[26]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Aldehyde dehydrogenase family 3 member A2 (ALDH3A2).	[2]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Aldehyde dehydrogenase family 3 member A2 (ALDH3A2).	[20]

22 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Aldehyde dehydrogenase family 3 member A2 (ALDH3A2).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Aldehyde dehydrogenase family 3 member A2 (ALDH3A2).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Aldehyde dehydrogenase family 3 member A2 (ALDH3A2).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Aldehyde dehydrogenase family 3 member A2 (ALDH3A2).	[6]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Aldehyde dehydrogenase family 3 member A2 (ALDH3A2).	[7]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Aldehyde dehydrogenase family 3 member A2 (ALDH3A2).	[8]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Aldehyde dehydrogenase family 3 member A2 (ALDH3A2).	[9]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Aldehyde dehydrogenase family 3 member A2 (ALDH3A2).	[10]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Aldehyde dehydrogenase family 3 member A2 (ALDH3A2).	[11]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Aldehyde dehydrogenase family 3 member A2 (ALDH3A2).	[12]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Aldehyde dehydrogenase family 3 member A2 (ALDH3A2).	[13]
Bicalutamide	DMZMSPF	Approved	Bicalutamide increases the expression of Aldehyde dehydrogenase family 3 member A2 (ALDH3A2).	[14]
Bezafibrate	DMZDCS0	Approved	Bezafibrate increases the expression of Aldehyde dehydrogenase family 3 member A2 (ALDH3A2).	[15]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Aldehyde dehydrogenase family 3 member A2 (ALDH3A2).	[16]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Aldehyde dehydrogenase family 3 member A2 (ALDH3A2).	[17]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Aldehyde dehydrogenase family 3 member A2 (ALDH3A2).	[18]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Aldehyde dehydrogenase family 3 member A2 (ALDH3A2).	[19]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Aldehyde dehydrogenase family 3 member A2 (ALDH3A2).	[21]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Aldehyde dehydrogenase family 3 member A2 (ALDH3A2).	[22]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Aldehyde dehydrogenase family 3 member A2 (ALDH3A2).	[23]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Aldehyde dehydrogenase family 3 member A2 (ALDH3A2).	[24]
PP-242	DM2348V	Investigative	PP-242 increases the expression of Aldehyde dehydrogenase family 3 member A2 (ALDH3A2).	[25]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [4] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [8] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [9] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [10] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [11] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [12] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [13] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
• [14] Microarray analysis of bicalutamide action on telomerase activity, p53 pathway and viability of prostate carcinoma cell lines. J Pharm Pharmacol. 2005 Jan;57(1):83-92.
• [15] Bezafibrate induces FALDH in human fibroblasts; implications for Sj?gren-Larsson syndrome. Mol Genet Metab. 2006 Sep-Oct;89(1-2):111-5. doi: 10.1016/j.ymgme.2006.05.009. Epub 2006 Jul 11.
• [16] The molecular basis of genistein-induced mitotic arrest and exit of self-renewal in embryonal carcinoma and primary cancer cell lines. BMC Med Genomics. 2008 Oct 10;1:49.
• [17] New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
• [18] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [19] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [20] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [21] Isobaric tags for relative and absolute quantitation-based proteomics analysis of the effect of ginger oil on bisphenol A-induced breast cancer cell proliferation. Oncol Lett. 2021 Feb;21(2):101. doi: 10.3892/ol.2020.12362. Epub 2020 Dec 8.
• [22] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [23] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [24] Microphysiological system modeling of ochratoxin A-associated nephrotoxicity. Toxicology. 2020 Nov;444:152582. doi: 10.1016/j.tox.2020.152582. Epub 2020 Sep 6.
• [25] Marine biogenics in sea spray aerosols interact with the mTOR signaling pathway. Sci Rep. 2019 Jan 24;9(1):675.
• [26] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.