General Information of Drug Off-Target (DOT) (ID: OT8PBOAR)

DOT Name Troponin T, slow skeletal muscle (TNNT1)
Synonyms TnTs; Slow skeletal muscle troponin T; sTnT
Gene Name TNNT1
Related Disease
Nemaline myopathy 5 ( )
Breast cancer ( )
Breast carcinoma ( )
Fabry disease ( )
Familial hypercholesterolemia ( )
Familial multiple trichoepithelioma ( )
Friedreich's ataxia ( )
Hypercholesterolemia, familial, 1 ( )
Myopathy ( )
Neoplasm ( )
Psoriasis ( )
Vitamin D deficiency ( )
Colorectal carcinoma ( )
Ewing sarcoma ( )
Metastatic malignant neoplasm ( )
Neuromuscular disease ( )
Rhabdomyosarcoma ( )
Triple negative breast cancer ( )
Chronic obstructive pulmonary disease ( )
Colon adenocarcinoma ( )
Coronary atherosclerosis ( )
Coronary heart disease ( )
GNE myopathy ( )
Nemaline myopathy ( )
Nemaline myopathy 5C, autosomal dominant ( )
UniProt ID
TNNT1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00992
Sequence
MSDTEEQEYEEEQPEEEAAEEEEEAPEEPEPVAEPEEERPKPSRPVVPPLIPPKIPEGER
VDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEK
ERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGRE
MKVRILSERKKPLDIDYMGEEQLRARSAWLPPSQPSCPAREKAQELSDWIHQLESEKFDL
MAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK
Function Troponin T is the tropomyosin-binding subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.
KEGG Pathway
Motor proteins (hsa04814 )
Cytoskeleton in muscle cells (hsa04820 )
Reactome Pathway
Striated Muscle Contraction (R-HSA-390522 )

Molecular Interaction Atlas (MIA) of This DOT

25 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Nemaline myopathy 5 DISNFIVZ Definitive Autosomal recessive [1]
Breast cancer DIS7DPX1 Strong Biomarker [2]
Breast carcinoma DIS2UE88 Strong Biomarker [2]
Fabry disease DISUUQJF Strong Biomarker [3]
Familial hypercholesterolemia DISC06IX Strong Genetic Variation [4]
Familial multiple trichoepithelioma DISKZAUY Strong Biomarker [5]
Friedreich's ataxia DIS5DV35 Strong Biomarker [3]
Hypercholesterolemia, familial, 1 DISU411W Strong Genetic Variation [4]
Myopathy DISOWG27 Strong Biomarker [6]
Neoplasm DISZKGEW Strong Biomarker [7]
Psoriasis DIS59VMN Strong Biomarker [8]
Vitamin D deficiency DISAWKYI Strong Altered Expression [9]
Colorectal carcinoma DIS5PYL0 moderate Altered Expression [10]
Ewing sarcoma DISQYLV3 moderate Biomarker [11]
Metastatic malignant neoplasm DIS86UK6 moderate Biomarker [12]
Neuromuscular disease DISQTIJZ moderate Biomarker [10]
Rhabdomyosarcoma DISNR7MS moderate Biomarker [11]
Triple negative breast cancer DISAMG6N moderate Genetic Variation [13]
Chronic obstructive pulmonary disease DISQCIRF Limited Biomarker [14]
Colon adenocarcinoma DISDRE0J Limited Biomarker [14]
Coronary atherosclerosis DISKNDYU Limited Genetic Variation [15]
Coronary heart disease DIS5OIP1 Limited Genetic Variation [15]
GNE myopathy DIS73X4W Limited Biomarker [16]
Nemaline myopathy DIS5IYLY Limited Autosomal dominant [1]
Nemaline myopathy 5C, autosomal dominant DIS4A084 Limited Autosomal dominant [17]
------------------------------------------------------------------------------------
⏷ Show the Full List of 25 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
21 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Troponin T, slow skeletal muscle (TNNT1). [18]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Troponin T, slow skeletal muscle (TNNT1). [19]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Troponin T, slow skeletal muscle (TNNT1). [20]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Troponin T, slow skeletal muscle (TNNT1). [21]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Troponin T, slow skeletal muscle (TNNT1). [22]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Troponin T, slow skeletal muscle (TNNT1). [23]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Troponin T, slow skeletal muscle (TNNT1). [24]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Troponin T, slow skeletal muscle (TNNT1). [25]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Troponin T, slow skeletal muscle (TNNT1). [26]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Troponin T, slow skeletal muscle (TNNT1). [27]
Fluorouracil DMUM7HZ Approved Fluorouracil decreases the expression of Troponin T, slow skeletal muscle (TNNT1). [28]
Cannabidiol DM0659E Approved Cannabidiol increases the expression of Troponin T, slow skeletal muscle (TNNT1). [29]
Mitoxantrone DMM39BF Approved Mitoxantrone decreases the expression of Troponin T, slow skeletal muscle (TNNT1). [20]
Daunorubicin DMQUSBT Approved Daunorubicin decreases the expression of Troponin T, slow skeletal muscle (TNNT1). [20]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Troponin T, slow skeletal muscle (TNNT1). [18]
Genistein DM0JETC Phase 2/3 Genistein decreases the expression of Troponin T, slow skeletal muscle (TNNT1). [30]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone increases the expression of Troponin T, slow skeletal muscle (TNNT1). [31]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Troponin T, slow skeletal muscle (TNNT1). [33]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Troponin T, slow skeletal muscle (TNNT1). [34]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Troponin T, slow skeletal muscle (TNNT1). [35]
Lithium chloride DMHYLQ2 Investigative Lithium chloride increases the expression of Troponin T, slow skeletal muscle (TNNT1). [36]
------------------------------------------------------------------------------------
⏷ Show the Full List of 21 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Troponin T, slow skeletal muscle (TNNT1). [32]
------------------------------------------------------------------------------------

References

1 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
2 TNNT1 facilitates proliferation of breast cancer cells by promoting G(1)/S phase transition.Life Sci. 2018 Sep 1;208:161-166. doi: 10.1016/j.lfs.2018.07.034. Epub 2018 Jul 19.
3 Value of cardiac biomarker measurement in the differential diagnosis of infiltrative cardiomyopathy patients with preserved left ventricular systolic function.J Thorac Dis. 2018 Aug;10(8):4966-4975. doi: 10.21037/jtd.2018.07.56.
4 Epigenetic and genetic variations at the TNNT1 gene locus are associated with HDL-C levels and coronary artery disease.Epigenomics. 2016 Mar;8(3):359-71. doi: 10.2217/epi.15.120. Epub 2016 Mar 7.
5 Molecular Analysis of Mixed Endometrioid and Serous Adenocarcinoma of the Endometrium.PLoS One. 2015 Jul 1;10(7):e0130909. doi: 10.1371/journal.pone.0130909. eCollection 2015.
6 The loss of slow skeletal muscle isoform of troponin T in spindle intrafusal fibres explains the pathophysiology of Amish nemaline myopathy.J Physiol. 2019 Aug;597(15):3999-4012. doi: 10.1113/JP278119. Epub 2019 Jul 3.
7 Platinum salts in the treatment of BRCA-associated breast cancer: A true targeted chemotherapy?.Crit Rev Oncol Hematol. 2019 Mar;135:66-75. doi: 10.1016/j.critrevonc.2019.01.016. Epub 2019 Jan 30.
8 Effectiveness of Lipid-Lowering Statin Therapy in Patients With and Without Psoriasis.Clin Drug Investig. 2017 Aug;37(8):775-785. doi: 10.1007/s40261-017-0533-0.
9 Disrupted expression of genes essential for skeletal muscle fibre integrity and energy metabolism in Vitamin D deficient rats.J Steroid Biochem Mol Biol. 2020 Mar;197:105525. doi: 10.1016/j.jsbmb.2019.105525. Epub 2019 Nov 6.
10 TNNT1, negatively regulated by miR-873, promotes the progression of colorectal cancer.J Gene Med. 2020 Feb;22(2):e3152. doi: 10.1002/jgm.3152. Epub 2019 Dec 23.
11 Artificial neural network inference (ANNI): a study on gene-gene interaction for biomarkers in childhood sarcomas.PLoS One. 2014 Jul 15;9(7):e102483. doi: 10.1371/journal.pone.0102483. eCollection 2014.
12 Factors Predicting Response, Perioperative Outcomes, and Survival Following Total Neoadjuvant Therapy for Borderline/Locally Advanced Pancreatic Cancer.Ann Surg. 2021 Feb 1;273(2):341-349. doi: 10.1097/SLA.0000000000003284.
13 Carboplatin in BRCA1/2-mutated and triple-negative breast cancer BRCAness subgroups: the TNT Trial.Nat Med. 2018 May;24(5):628-637. doi: 10.1038/s41591-018-0009-7. Epub 2018 Apr 30.
14 TNNT1, a prognostic indicator in colon adenocarcinoma, regulates cell behaviors and mediates EMT process.Biosci Biotechnol Biochem. 2020 Jan;84(1):111-117. doi: 10.1080/09168451.2019.1664891. Epub 2019 Sep 12.
15 Triglyceride-Rich Lipoprotein Cholesterol and Risk of Cardiovascular Events Among Patients Receiving Statin Therapy in the TNT Trial.Circulation. 2018 Aug 21;138(8):770-781. doi: 10.1161/CIRCULATIONAHA.117.032318.
16 'Amish Nemaline Myopathy' in 2 Italian siblings harbouring a novel homozygous mutation in Troponin-I gene.Neuromuscul Disord. 2019 Oct;29(10):766-770. doi: 10.1016/j.nmd.2019.09.005. Epub 2019 Sep 6.
17 Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
18 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
19 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
20 Identification of genomic biomarkers for anthracycline-induced cardiotoxicity in human iPSC-derived cardiomyocytes: an in vitro repeated exposure toxicity approach for safety assessment. Arch Toxicol. 2016 Nov;90(11):2763-2777.
21 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
22 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
23 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
24 Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
25 Functional cardiotoxicity assessment of cosmetic compounds using human-induced pluripotent stem cell-derived cardiomyocytes. Arch Toxicol. 2018 Jan;92(1):371-381.
26 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
27 Epigenetic silencing of novel tumor suppressors in malignant melanoma. Cancer Res. 2006 Dec 1;66(23):11187-93. doi: 10.1158/0008-5472.CAN-06-1274.
28 Dissecting progressive stages of 5-fluorouracil resistance in vitro using RNA expression profiling. Int J Cancer. 2004 Nov 1;112(2):200-12. doi: 10.1002/ijc.20401.
29 Effects of non-euphoric plant cannabinoids on muscle quality and performance of dystrophic mdx mice. Br J Pharmacol. 2019 May;176(10):1568-1584. doi: 10.1111/bph.14460. Epub 2018 Sep 9.
30 Gene expression profiling in Ishikawa cells: a fingerprint for estrogen active compounds. Toxicol Appl Pharmacol. 2009 Apr 1;236(1):85-96.
31 Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
32 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
33 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
34 Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
35 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
36 Effects of lithium and valproic acid on gene expression and phenotypic markers in an NT2 neurosphere model of neural development. PLoS One. 2013;8(3):e58822.