Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTC3D894)

DOT Name Sodium-dependent phosphate transporter 1 (SLC20A1)
Synonyms Gibbon ape leukemia virus receptor 1; GLVR-1; Leukemia virus receptor 1 homolog; Phosphate transporter 1; PiT-1; Solute carrier family 20 member 1
Gene Name SLC20A1
UniProt ID
S20A1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF01384
Sequence
MATLITSTTAATAASGPLVDYLWMLILGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLK
QACILASIFETVGSVLLGAKVSETIRKGLIDVEMYNSTQGLLMAGSVSAMFGSAVWQLVA
SFLKLPISGTHCIVGATIGFSLVAKGQEGVKWSELIKIVMSWFVSPLLSGIMSGILFFLV
RAFILHKADPVPNGLRALPVFYACTVGINLFSIMYTGAPLLGFDKLPLWGTILISVGCAV
FCALIVWFFVCPRMKRKIEREIKCSPSESPLMEKKNSLKEDHEETKLSVGDIENKHPVSE
VGPATVPLQAVVEERTVSFKLGDLEEAPERERLPSVDLKEETSIDSTVNGAVQLPNGNLV
QFSQAVSNQINSSGHYQYHTVHKDSGLYKELLHKLHLAKVGDCMGDSGDKPLRRNNSYTS
YTMAICGMPLDSFRAKEGEQKGEEMEKLTWPNADSKKRIRMDSYTSYCNAVSDLHSASEI
DMSVKAEMGLGDRKGSNGSLEEWYDQDKPEVSLLFQFLQILTACFGSFAHGGNDVSNAIG
PLVALYLVYDTGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDLTPITPSSGF
SIELASALTVVIASNIGLPISTTHCKVGSVVSVGWLRSKKAVDWRLFRNIFMAWFVTVPI
SGVISAAIMAIFRYVILRM
Function
Sodium-phosphate symporter which preferentially transports the monovalent form of phosphate with a stoichiometry of two sodium ions per phosphate ion. May play a role in extracellular matrix and cartilage calcification as well as in vascular calcification. Essential for cell proliferation but this function is independent of its phosphate transporter activity ; (Microbial infection) May function as a retroviral receptor as it confers human cells susceptibility to infection to Gibbon Ape Leukemia Virus (GaLV), Simian sarcoma-associated virus (SSAV) and Feline leukemia virus subgroup B (FeLV-B) as well as 10A1 murine leukemia virus (10A1 MLV).
Tissue Specificity Ubiquitously expressed.
Reactome Pathway
Sodium-coupled phosphate cotransporters (R-HSA-427652 )
BioCyc Pathway
MetaCyc:ENSG00000144136-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Sodium-dependent phosphate transporter 1 (SLC20A1). [1]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Sodium-dependent phosphate transporter 1 (SLC20A1). [23]
Coumarin DM0N8ZM Investigative Coumarin decreases the phosphorylation of Sodium-dependent phosphate transporter 1 (SLC20A1). [23]
------------------------------------------------------------------------------------
32 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [3]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [6]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [7]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [8]
Quercetin DM3NC4M Approved Quercetin increases the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [9]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [10]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [11]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [12]
Menadione DMSJDTY Approved Menadione affects the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [11]
Azathioprine DMMZSXQ Approved Azathioprine increases the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [13]
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate increases the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [14]
Dasatinib DMJV2EK Approved Dasatinib decreases the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [15]
Zidovudine DM4KI7O Approved Zidovudine decreases the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [16]
Phosphate DMUXQG7 Approved Phosphate increases the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [17]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [18]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [19]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [20]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [21]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [22]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN increases the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [24]
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [25]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [26]
Milchsaure DM462BT Investigative Milchsaure increases the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [27]
Sulforaphane DMQY3L0 Investigative Sulforaphane increases the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [28]
chloropicrin DMSGBQA Investigative chloropicrin affects the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [29]
methyl p-hydroxybenzoate DMO58UW Investigative methyl p-hydroxybenzoate increases the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [30]
Lithium chloride DMHYLQ2 Investigative Lithium chloride increases the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [31]
Rutin DMEHRAJ Investigative Rutin increases the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [32]
CATECHIN DMY38SB Investigative CATECHIN increases the expression of Sodium-dependent phosphate transporter 1 (SLC20A1). [32]
------------------------------------------------------------------------------------
⏷ Show the Full List of 32 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Evidence for a role of claudin 2 as a proximal tubular stress responsive paracellular water channel. Toxicol Appl Pharmacol. 2014 Sep 1;279(2):163-72.
3 Systems analysis of transcriptome and proteome in retinoic acid/arsenic trioxide-induced cell differentiation/apoptosis of promyelocytic leukemia. Proc Natl Acad Sci U S A. 2005 May 24;102(21):7653-8.
4 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
8 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
9 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
10 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
11 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
12 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
13 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
14 CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
15 Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
16 Differential gene expression in human hepatocyte cell lines exposed to the antiretroviral agent zidovudine. Arch Toxicol. 2014 Mar;88(3):609-23. doi: 10.1007/s00204-013-1169-3. Epub 2013 Nov 30.
17 High expression of the Pi-transporter SLC20A1/Pit1 in calcific aortic valve disease promotes mineralization through regulation of Akt-1. PLoS One. 2013;8(1):e53393. doi: 10.1371/journal.pone.0053393. Epub 2013 Jan 4.
18 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
19 Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
20 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
21 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
22 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
23 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
24 Chemical stresses fail to mimic the unfolded protein response resulting from luminal load with unfolded polypeptides. J Biol Chem. 2018 Apr 13;293(15):5600-5612.
25 Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
26 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
27 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
28 Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
29 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
30 Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
31 Early gene response in lithium chloride induced apoptosis. Apoptosis. 2005 Jan;10(1):75-90. doi: 10.1007/s10495-005-6063-x.
32 Epicatechin and a cocoa polyphenolic extract modulate gene expression in human Caco-2 cells. J Nutr. 2004 Oct;134(10):2509-16.