Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCO4NEI)

DOT Name Serine/threonine-protein kinase SBK1 (SBK1)
Synonyms EC 2.7.11.1; SH3 domain-binding kinase 1
Gene Name SBK1
Related Disease
Advanced cancer ( )
Corneal dystrophy, Fuchs endothelial, 1 ( )
Esophageal squamous cell carcinoma ( )
Fuchs' endothelial dystrophy ( )
Gastric adenocarcinoma ( )
Neoplasm ( )
Acute myelogenous leukaemia ( )
Systemic lupus erythematosus ( )
UniProt ID
SBK1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
2.7.11.1
Pfam ID
PF00069
Sequence
MSVGCPEPEPPRSLTCCGPGTAPGPGAGVPLLTEDMQALTLRTLAASDVTKHYELVRELG
KGTYGKVDLVVYKGTGTKMALKFVNKSKTKLKNFLREVSITNSLSSSPFIIKVFDVVFET
EDCYVFAQEYAPAGDLFDIIPPQVGLPEDTVKRCVQQLGLALDFMHGRQLVHRDIKPENV
LLFDRECRRVKLADFGMTRRVGCRVKRVSGTIPYTAPEVCQAGRADGLAVDTGVDVWAFG
VLIFCVLTGNFPWEAASGADAFFEEFVRWQRGRLPGLPSQWRRFTEPALRMFQRLLALEP
ERRGPAKEVFRFLKHELTSELRRRPSHRARKPPGDRPPAAGPLRLEAPGPLKRTVLTESG
SGSRPAPPAVGSVPLPVPVPVPVPVPVPVPEPGLAPQGPPGRTDGRADKSKGQVVLATAI
EICV
Function May be involved in signal-transduction pathways related to the control of brain development.

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Genetic Variation [1]
Corneal dystrophy, Fuchs endothelial, 1 DISOQIO0 Strong Biomarker [2]
Esophageal squamous cell carcinoma DIS5N2GV Strong Altered Expression [1]
Fuchs' endothelial dystrophy DISL7TXC Strong Biomarker [2]
Gastric adenocarcinoma DISWWLTC Strong Altered Expression [1]
Neoplasm DISZKGEW Strong Altered Expression [1]
Acute myelogenous leukaemia DISCSPTN moderate Genetic Variation [3]
Systemic lupus erythematosus DISI1SZ7 Limited Genetic Variation [4]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Serine/threonine-protein kinase SBK1 (SBK1). [5]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the methylation of Serine/threonine-protein kinase SBK1 (SBK1). [14]
------------------------------------------------------------------------------------
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Serine/threonine-protein kinase SBK1 (SBK1). [6]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Serine/threonine-protein kinase SBK1 (SBK1). [7]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Serine/threonine-protein kinase SBK1 (SBK1). [8]
Hydroquinone DM6AVR4 Approved Hydroquinone decreases the expression of Serine/threonine-protein kinase SBK1 (SBK1). [9]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Serine/threonine-protein kinase SBK1 (SBK1). [10]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Serine/threonine-protein kinase SBK1 (SBK1). [11]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Serine/threonine-protein kinase SBK1 (SBK1). [12]
UNC0379 DMD1E4J Preclinical UNC0379 decreases the expression of Serine/threonine-protein kinase SBK1 (SBK1). [13]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Serine/threonine-protein kinase SBK1 (SBK1). [15]
Acetaldehyde DMJFKG4 Investigative Acetaldehyde increases the expression of Serine/threonine-protein kinase SBK1 (SBK1). [16]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)

References

1 Human SBK1 is dysregulated in multiple cancers and promotes survival of ovary cancer SK-OV-3 cells.Mol Biol Rep. 2011 Jun;38(5):3551-9. doi: 10.1007/s11033-010-0465-8. Epub 2010 Nov 20.
2 Results of Femtosecond Laser-Assisted Descemet Stripping Automated Endothelial Keratoplasty.J Ophthalmol. 2017;2017:8984367. doi: 10.1155/2017/8984367. Epub 2017 Jun 11.
3 Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
4 Transancestral mapping and genetic load in systemic lupus erythematosus.Nat Commun. 2017 Jul 17;8:16021. doi: 10.1038/ncomms16021.
5 Nuclear and Mitochondrial DNA Methylation Patterns Induced by Valproic Acid in Human Hepatocytes. Chem Res Toxicol. 2017 Oct 16;30(10):1847-1854. doi: 10.1021/acs.chemrestox.7b00171. Epub 2017 Sep 13.
6 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
7 Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
8 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
9 Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
10 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
11 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
12 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
13 Epigenetic siRNA and chemical screens identify SETD8 inhibition as a therapeutic strategy for p53 activation in high-risk neuroblastoma. Cancer Cell. 2017 Jan 9;31(1):50-63.
14 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
15 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
16 Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.