General Information of Drug Off-Target (DOT) (ID: OTDTL9UE)

DOT Name Putative methyltransferase NSUN7 (NSUN7)
Synonyms EC 2.1.1.-; NOL1/NOP2/Sun domain family member 7
Gene Name NSUN7
Related Disease
Male infertility ( )
UniProt ID
NSUN7_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
2.1.1.-
Pfam ID
PF01189 ; PF21148
Sequence
MLNSTGELEFSNEEDPEIISQLTSLPLSGGKSSAGVPEKTGYPDSVYVMAANIFQGIRIE
KSAQKVLIKYGNEPLRSLSESEDQSFQRLSYELAFSALKYQDILETILIDSCIFPSTTIP
DHLSSLIIVMLYDFQDRKFQTRVLSDNEEPISEVQEVENLLNSFKIKLAAALARCRIKHD
ALSIYHILPETVRKQELRASTLPLYAWINTCKISPEEVYNNLKRRGYNKVKSVLHIDDKV
FAVDQHCYDVLIFPSHLKNDLINIDLFKDYKLIFQDKSRSLAVHSVKALLNMDDDVLMVN
TGSWYTVSHMSILTNNNTSKVFVCGVQSQAKDPDLKTLFTKIGCKNIEILHEKFINIESK
DHRLQKVKVILLLPRCSGLGVSNPVEFILNEHEDTEFLKDHSQGGISVDKLHVLAQQQYE
QLTHAMKFTKAQAVVYCTCSVFPEENEAVVKKALEFQDLGNKGQPYRLSPPVLPLCSLKE
IQLSTDKFFRMEPSEITNGCFLSILTRERDPSETVSVNDVLARAAAKGLLDGIELGKSSK
REKKKKKSKTSLTKGATTDNGIQMKIAEFLNRETKASANLSETVTKPPLPQKNTAQVGAS
SQTRKPNKLAPHPAVPAFVKNTCPSRPRERQTHFLRPRPEDRMVALKPIKIVLPPVFMPF
SSPQGIRSRMPTQHLYCRWVAPKALVPTCLPTHSLSRKEEKPKDDTPSSLLRPPRRWL
Function May have S-adenosyl-L-methionine-dependent methyl-transferase activity.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Male infertility DISY3YZZ Strong Genetic Variation [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Putative methyltransferase NSUN7 (NSUN7). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Putative methyltransferase NSUN7 (NSUN7). [3]
Cisplatin DMRHGI9 Approved Cisplatin affects the expression of Putative methyltransferase NSUN7 (NSUN7). [4]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Putative methyltransferase NSUN7 (NSUN7). [5]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Putative methyltransferase NSUN7 (NSUN7). [4]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Putative methyltransferase NSUN7 (NSUN7). [6]
Belinostat DM6OC53 Phase 2 Belinostat decreases the expression of Putative methyltransferase NSUN7 (NSUN7). [6]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Putative methyltransferase NSUN7 (NSUN7). [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Putative methyltransferase NSUN7 (NSUN7). [7]
------------------------------------------------------------------------------------

References

1 The Nsun7 (A11337)-deletion mutation, causes reduction of its protein rate and associated with sperm motility defect in infertile men.J Assist Reprod Genet. 2015 May;32(5):807-15. doi: 10.1007/s10815-015-0443-0. Epub 2015 Feb 22.
2 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
3 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
4 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
5 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
6 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
7 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
8 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.