Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDWN6NX)

• DOT Name: Beta-2-microglobulin (B2M)
• Gene Name: B2M
• Related Disease:
  Hypoproteinemia, hypercatabolic
  MHC class I deficiency
  Variant ABeta2M amyloidosis
  Familial visceral amyloidosis
• UniProt ID: B2MG_HUMAN
• PDB ID: 1A1M ; 1A1N ; 1A1O ; 1A6Z ; 1A9B ; 1A9E ; 1AGB ; 1AGC ; 1AGD ; 1AGE ; 1AGF ; 1AKJ ; 1AO7 ; 1B0G ; 1B0R ; 1BD2 ; 1C16 ; 1CE6 ; 1CG9 ; 1DE4 ; 1DUY ; 1DUZ ; 1E27 ; 1E28 ; 1EEY ; 1EEZ ; 1EFX ; 1EXU ; 1GZP ; 1GZQ ; 1HHG ; 1HHH ; 1HHI ; 1HHJ ; 1HHK ; 1HLA ; 1HSA ; 1HSB ; 1I1F ; 1I1Y ; 1I4F ; 1I7R ; 1I7T ; 1I7U ; 1IM3 ; 1IM9 ; 1JF1 ; 1JGD ; 1JGE ; 1JHT ; 1JNJ ; 1K5N ; 1KPR ; 1KTL ; 1LDS ; 1LP9 ; 1M05 ; 1M6O ; 1MHE ; 1MI5 ; 1N2R ; 1OF2 ; 1OGA ; 1OGT ; 1ONQ ; 1P7Q ; 1PY4 ; 1Q94 ; 1QEW ; 1QLF ; 1QQD ; 1QR1 ; 1QRN ; 1QSE ; 1QSF ; 1QVO ; 1R3H ; 1S8D ; 1S9W ; 1S9X ; 1S9Y ; 1SYS ; 1SYV ; 1T1W ; 1T1X ; 1T1Y ; 1T1Z ; 1T20 ; 1T21 ; 1T22 ; 1TMC ; 1TVB ; 1TVH ; 1UQS ; 1UXS ; 1UXW ; 1VGK ; 1W0V ; 1W0W ; 1W72 ; 1X7Q ; 1XH3 ; 1XR8 ; 1XR9 ; 1XZ0 ; 1YDP ; 1YPZ ; 1ZHK ; 1ZHL ; 1ZS8 ; 1ZSD ; 1ZT4 ; 1ZVS ; 2A83 ; 2AK4 ; 2AV1 ; 2AV7 ; 2AXF ; 2AXG ; 2BCK ; 2BNQ ; 2BNR ; 2BSR ; 2BSS ; 2BST ; 2BVO ; 2BVP ; 2BVQ ; 2C7U ; 2CII ; 2CIK ; 2CLR ; 2D31 ; 2D4D ; 2D4F ; 2DYP ; 2E8D ; 2ESV ; 2F53 ; 2F54 ; 2F74 ; 2F8O ; 2FYY ; 2FZ3 ; 2GIT ; 2GJ6 ; 2GT9 ; 2GTW ; 2GTZ ; 2GUO ; 2H26 ; 2H6P ; 2HJK ; 2HJL ; 2HLA ; 2HN7 ; 2J8U ; 2JCC ; 2NW3 ; 2NX5 ; 2P5E ; 2P5W ; 2PO6 ; 2PYE ; 2RFX ; 2UWE ; 2V2W ; 2V2X ; 2VB5 ; 2VLJ ; 2VLK ; 2VLL ; 2VLR ; 2X4N ; 2X4O ; 2X4P ; 2X4Q ; 2X4R ; 2X4S ; 2X4T ; 2X4U ; 2X70 ; 2X89 ; 2XKS ; 2XKU ; 2XPG ; 2YPK ; 2YPL ; 2YXF ; 2Z9T ; 3AM8 ; 3B3I ; 3B6S ; 3BGM ; 3BH8 ; 3BH9 ; 3BHB ; 3BO8 ; 3BP4 ; 3BP7 ; 3BVN ; 3BW9 ; 3BWA ; 3BXN ; 3BZE ; 3BZF ; 3C9N ; 3CDG ; 3CII ; 3CIQ ; 3CZF ; 3D18 ; 3D25 ; 3D2U ; 3D39 ; 3D3V ; 3DBX ; 3DHJ ; 3DHM ; 3DTX ; 3DX6 ; 3DX7 ; 3DX8 ; 3DXA ; 3EKC ; 3FFC ; 3FQN ; 3FQR ; 3FQT ; 3FQU ; 3FQW ; 3FQX ; 3FT2 ; 3FT3 ; 3FT4 ; 3GIV ; 3GJF ; 3GSN ; 3GSO ; 3GSQ ; 3GSR ; 3GSU ; 3GSV ; 3GSW ; 3GSX ; 3H7B ; 3H9H ; 3H9S ; 3HAE ; 3HCV ; 3HG1 ; 3HLA ; 3HPJ ; 3HUJ ; 3I6G ; 3I6K ; 3I6L ; 3IB4 ; 3IXA ; 3JTS ; 3KLA ; 3KPL ; 3KPM ; 3KPN ; 3KPO ; 3KPP ; 3KPQ ; 3KPR ; 3KPS ; 3KWW ; 3KXF ; 3KYN ; 3KYO ; 3L3D ; 3L3G ; 3L3I ; 3L3J ; 3L3K ; 3LKN ; 3LKO ; 3LKP ; 3LKQ ; 3LKR ; 3LKS ; 3LN4 ; 3LN5 ; 3LOW ; 3LOZ ; 3LV3 ; 3M17 ; 3M1B ; 3MGO ; 3MGT ; 3MR9 ; 3MRB ; 3MRC ; 3MRD ; 3MRE ; 3MRF ; 3MRG ; 3MRH ; 3MRI ; 3MRJ ; 3MRK ; 3MRL ; 3MRM ; 3MRN ; 3MRO ; 3MRP ; 3MRQ ; 3MRR ; 3MV7 ; 3MV8 ; 3MV9 ; 3MYJ ; 3MYZ ; 3MZT ; 3NA4 ; 3NFN ; 3O3A ; 3O3B ; 3O3D ; 3O3E ; 3O4L ; 3OV6 ; 3OX8 ; 3OXR ; 3OXS ; 3PWJ ; 3PWL ; 3PWN ; 3PWP ; 3QDA ; 3QDG ; 3QDJ ; 3QDM ; 3QEQ ; 3QFD ; 3QFJ ; 3QZW ; 3REW ; 3RL1 ; 3RL2 ; 3RWJ ; 3S6C ; 3SDX ; 3SJV ; 3SKM ; 3SKO ; 3SPV ; 3T8X ; 3TID ; 3TIE ; 3TLR ; 3TM6 ; 3TO2 ; 3TZV ; 3U0P ; 3UPR ; 3UTQ ; 3UTS ; 3UTT ; 3V5D ; 3V5H ; 3V5K ; 3VCL ; 3VFM ; 3VFN ; 3VFO ; 3VFP ; 3VFR ; 3VFS ; 3VFT ; 3VFU ; 3VFV ; 3VFW ; 3VH8 ; 3VRI ; 3VRJ ; 3VWJ ; 3VWK ; 3VXM ; 3VXN ; 3VXO ; 3VXP ; 3VXR ; 3VXS ; 3VXU ; 3W0W ; 3W39 ; 3WL9 ; 3WLB ; 3WUW ; 3X11 ; 3X12 ; 3X13 ; 3X14 ; 4E0K ; 4E0L ; 4E5X ; 4EN3 ; 4EUP ; 4F7M ; 4F7P ; 4F7T ; 4FTV ; 4FXL ; 4G8G ; 4G8I ; 4G9D ; 4G9F ; 4GKN ; 4GKS ; 4GUP ; 4HKJ ; 4HWZ ; 4HX1 ; 4I48 ; 4I4W ; 4JFD ; 4JFE ; 4JFF ; 4JFO ; 4JFP ; 4JFQ ; 4JQV ; 4JQX ; 4JRX ; 4JRY ; 4K71 ; 4K7F ; 4KDT ; 4L29 ; 4L3C ; 4L3E ; 4L4T ; 4L4V ; 4LCW ; 4LCY ; 4LHU ; 4LNR ; 4M8V ; 4MJ5 ; 4MJ6 ; 4MJI ; 4MNQ ; 4N0F ; 4N0U ; 4N8V ; 4NNX ; 4NNY ; 4NO0 ; 4NO2 ; 4NO3 ; 4NO5 ; 4NQC ; 4NQD ; 4NQE ; 4NQV ; 4NQX ; 4NT6 ; 4O2C ; 4O2E ; 4O2F ; 4ONO ; 4PJ5 ; 4PJ7 ; 4PJ8 ; 4PJ9 ; 4PJA ; 4PJB ; 4PJC ; 4PJD ; 4PJE ; 4PJF ; 4PJG ; 4PJH ; 4PJI ; 4PJX ; 4PR5 ; 4PRA ; 4PRB ; 4PRD ; 4PRE ; 4PRH ; 4PRI ; 4PRN ; 4PRP ; 4QOK ; 4QRP ; 4QRQ ; 4QRR ; 4QRS ; 4QRT ; 4QRU ; 4R9H ; 4RA3 ; 4RAH ; 4RMQ ; 4RMR ; 4RMS ; 4RMT ; 4RMU ; 4RMV ; 4RMW ; 4U1H ; 4U1I ; 4U1J ; 4U1K ; 4U1L ; 4U1M ; 4U1N ; 4U1S ; 4U6X ; 4U6Y ; 4UQ2 ; 4UQ3 ; 4WC8 ; 4WDI ; 4WJ5 ; 4WO4 ; 4WU5 ; 4WU7 ; 4WUU ; 4WW2 ; 4WWK ; 4X0S ; 4X6C ; 4X6D ; 4X6E ; 4X6F ; 4XXC ; 4Z76 ; 4Z77 ; 4Z78 ; 5B38 ; 5B39 ; 5BJT ; 5BRZ ; 5BS0 ; 5BXF ; 5C07 ; 5C08 ; 5C09 ; 5C0A ; 5C0B ; 5C0C ; 5C0D ; 5C0E ; 5C0F ; 5C0G ; 5C0I ; 5C0J ; 5C9J ; 5CFH ; 5CKA ; 5CKG ; 5CS7 ; 5CSB ; 5CSG ; 5D2L ; 5D2N ; 5D5M ; 5D7I ; 5D7J ; 5D7L ; 5D9S ; 5DDH ; 5DEF ; 5DEG ; 5E00 ; 5E6I ; 5E9D ; 5ENW ; 5EO0 ; 5EO1 ; 5EOT ; 5EU3 ; 5EU4 ; 5EU5 ; 5EU6 ; 5EUO ; 5F1I ; 5F7D ; 5F9J ; 5FA3 ; 5FA4 ; 5FDW ; 5GR7 ; 5GRD ; 5GRG ; 5GSB ; 5GSD ; 5GSR ; 5GSV ; 5GSX ; 5HGA ; 5HGB ; 5HGD ; 5HGH ; 5HHM ; 5HHN ; 5HHO ; 5HHP ; 5HHQ ; 5HYJ ; 5IB1 ; 5IB2 ; 5IB3 ; 5IB4 ; 5IB5 ; 5IEH ; 5IEK ; 5IM7 ; 5INC ; 5IND ; 5IRO ; 5ISZ ; 5IUE ; 5J1A ; 5JHD ; 5JZI ; 5KNM ; 5L2J ; 5L2K ; 5MEN ; 5MEO ; 5MEP ; 5MEQ ; 5MER ; 5N1Y ; 5N6B ; 5NHT ; 5NME ; 5NMF ; 5NMG ; 5NMH ; 5NMK ; 5NQ1 ; 5NQ3 ; 5NQK ; 5OPI ; 5SWQ ; 5T6W ; 5T6X ; 5T6Y ; 5T6Z ; 5T70 ; 5TEZ ; 5TRZ ; 5TS1 ; 5TXS ; 5U16 ; 5U17 ; 5U1R ; 5U2V ; 5U6Q ; 5U72 ; 5U98 ; 5V5L ; 5V5M ; 5VGD ; 5VGE ; 5VUD ; 5VUE ; 5VUF ; 5VVP ; 5VWD ; 5VWF ; 5VWH ; 5VWJ ; 5VZ5 ; 5W1V ; 5W1W ; 5W67 ; 5W69 ; 5W6A ; 5WER ; 5WHK ; 5WJL ; 5WJN ; 5WKE ; 5WKF ; 5WKG ; 5WKH ; 5WKI ; 5WL1 ; 5WMN ; 5WMO ; 5WMP ; 5WMQ ; 5WMR ; 5WSH ; 5WWI ; 5WWJ ; 5WWU ; 5WXC ; 5WXD ; 5XOS ; 5XOT ; 5XOV ; 5YXN ; 5YXU ; 6AEE ; 6AM5 ; 6AMT ; 6AMU ; 6APN ; 6AT5 ; 6AT9 ; 6AVF ; 6AVG ; 6BJ2 ; 6BJ3 ; 6BJ8 ; 6BXP ; 6BXQ ; 6C09 ; 6C15 ; 6C97 ; 6C98 ; 6C99 ; 6CUG ; 6D29 ; 6D2B ; 6D2R ; 6D2T ; 6D64 ; 6D78 ; 6DKP ; 6EI2 ; 6ENY ; 6EQA ; 6EQB ; 6EWA ; 6EWC ; 6EWO ; 6FGB ; 6G3J ; 6G3K ; 6GGM ; 6GH1 ; 6GH4 ; 6GHN ; 6GK3 ; 6GL1 ; 6ID4 ; 6IEX ; 6ILM ; 6J1V ; 6J1W ; 6J29 ; 6J2A ; 6J2E ; 6J2G ; 6J2H ; 6J2I ; 6J2J ; 6JOZ ; 6JP3 ; 6JTN ; 6JTO ; 6JTP ; 6K60 ; 6K7T ; 6LA6 ; 6LA7 ; 6M1B ; 6M24 ; 6M2J ; 6M2K ; 6MPP ; 6MT3 ; 6MT4 ; 6MT5 ; 6MT6 ; 6MTL ; 6MTM ; 6MWR ; 6NCA ; 6NHA ; 6NPR ; 6NUX ; 6O4Y ; 6O4Z ; 6O51 ; 6O53 ; 6O9B ; 6O9C ; 6OPD ; 6P23 ; 6P27 ; 6P2C ; 6P2F ; 6P2S ; 6P64 ; 6PA1 ; 6PAG ; 6PBH ; 6PTB ; 6PTE ; 6PUC ; 6PUD ; 6PUE ; 6PUF ; 6PUG ; 6PUH ; 6PUI ; 6PUJ ; 6PUK ; 6PUL ; 6PUM ; 6PVC ; 6PVD ; 6PYJ ; 6PYL ; 6PYV ; 6PYW ; 6PZ5 ; 6Q3K ; 6Q3S ; 6QIO ; 6QIP ; 6R2L ; 6RP9 ; 6RPA ; 6RPB ; 6RSY ; 6SS7 ; 6SS8 ; 6SS9 ; 6SSA ; 6TDO ; 6TDP ; 6TDQ ; 6TDR ; 6TDS ; 6TMO ; 6TRN ; 6TRO ; 6UJ7 ; 6UJ8 ; 6UJ9 ; 6UJO ; 6UJQ ; 6UK2 ; 6UK4 ; 6ULI ; 6ULK ; 6ULN ; 6ULR ; 6UON ; 6UZ1 ; 6UZM ; 6UZN ; 6UZO ; 6UZP ; 6UZQ ; 6UZS ; 6V2O ; 6V2P ; 6V2Q ; 6V3J ; 6V7Y ; 6V7Z ; 6V80 ; 6VB0 ; 6VB1 ; 6VB2 ; 6VB3 ; 6VB4 ; 6VB5 ; 6VB6 ; 6VB7 ; 6VIU ; 6VM7 ; 6VM8 ; 6VM9 ; 6VMA ; 6VMC ; 6VMX ; 6VPZ ; 6VQ2 ; 6VQD ; 6VQE ; 6VQO ; 6VQY ; 6VQZ ; 6VR1 ; 6VR5 ; 6VRM ; 6VRN ; 6W51 ; 6W9U ; 6W9V ; 6WNA ; 6WOL ; 6WZY ; 6X00 ; 6XQA ; 6XQP ; 6Y26 ; 6Y27 ; 6Y28 ; 6Y29 ; 6Y2A ; 6Y2B ; 6Z9V ; 6Z9W ; 6Z9X ; 6ZKW ; 6ZKX ; 6ZKY ; 6ZKZ ; 7AFV ; 7ALO ; 7B5F ; 7BBG ; 7BH8 ; 7C9V ; 7CIQ ; 7CIR ; 7CIS ; 7DUU ; 7DYN ; 7DZM ; 7DZN ; 7EDO ; 7EJL ; 7EJM ; 7EJN ; 7EU2 ; 7F4W ; 7JWI ; 7JYU ; 7JYV ; 7JYW ; 7JYX ; 7K80 ; 7K81 ; 7KGO ; 7KGP ; 7KGQ ; 7KGR ; 7KGS ; 7KGT ; 7KOZ ; 7KP0 ; 7KP1 ; 7L1B ; 7L1C ; 7L1D ; 7LFZ ; 7LG0 ; 7LG2 ; 7LG3 ; 7LGD ; 7LGT ; 7LLI ; 7LLJ ; 7M8S ; 7M8T ; 7M8U ; 7MJ6 ; 7MJ7 ; 7MJ8 ; 7MJ9 ; 7MJA ; 7MKB ; 7MLE ; 7MX4 ; 7MXF ; 7MXH ; 7N1A ; 7N1B ; 7N1E ; 7N1F ; 7N2N ; 7N2O ; 7N2P ; 7N2Q ; 7N2R ; 7N2S ; 7N4K ; 7N5C ; 7N5P ; 7N5Q ; 7N6D ; 7N6E ; 7N9J ; 7NA5 ; 7NDQ ; 7NDT ; 7NDU ; 7NMC ; 7NMD ; 7NME ; 7NMF ; 7NMG ; 7NMO ; 7NMR ; 7NMT ; 7NMV ; 7NMY ; 7NN5 ; 7NUI ; 7OW3 ; 7OW4 ; 7OW5 ; 7OW6 ; 7P3D ; 7P3E ; 7P49 ; 7P4B ; 7PB2 ; 7PBC ; 7PBE ; 7PDW ; 7PHR ; 7Q15 ; 7Q98 ; 7Q99 ; 7Q9A ; 7Q9B ; 7QNG ; 7QPD ; 7QPJ ; 7R7V ; 7R7W ; 7R7X ; 7R7Y ; 7R80 ; 7RE7 ; 7RE8 ; 7RK7 ; 7RM4 ; 7RRG ; 7RTD ; 7RTR ; 7RYM ; 7RYN ; 7RYO ; 7RZD ; 7RZJ ; 7S79 ; 7S7D ; 7S7E ; 7S7F ; 7S8A ; 7S8E ; 7S8F ; 7S8Q ; 7S8R ; 7S8S ; 7SA2 ; 7SH4 ; 7SIF ; 7SIG ; 7SIH ; 7SIS ; 7STF ; 7SU9 ; 7T0L ; 7T5M ; 7TLT ; 7TR4 ; 7TUC ; 7TUD ; 7TUE ; 7U1R ; 7U21 ; 7UC5 ; 7UFJ ; 7UM2 ; 7UMG ; 7UR1 ; 7WJ2 ; 7WJ3 ; 7WKJ ; 7WT3 ; 7WT4 ; 7WT5 ; 7WZZ ; 7X00 ; 7X1B ; 7X1C ; 7XF3 ; 7YG3 ; 7ZT2 ; 7ZT3 ; 7ZT4 ; 7ZT5 ; 7ZT7 ; 7ZT8 ; 7ZT9 ; 7ZUC ; 8A7O ; 8A7P ; 8A7Q ; 8A7T ; 8BP6 ; 8CX4 ; 8DNT ; 8DV3 ; 8DV4 ; 8DVG ; 8E13 ; 8E2Z ; 8E8I ; 8EB2 ; 8EC5 ; 8EK5 ; 8ELG ; 8ELH ; 8ERX ; 8ES8 ; 8ES9 ; 8ESA ; 8ESH ; 8GLE ; 8GLF ; 8GLG ; 8GLH ; 8GLI ; 8GOM ; 8GON ; 8GVB ; 8GVG ; 8GVI ; 8I5C ; 8I5D ; 8I5E ; 8ISN ; 8SBK ; 8SBL ; 8SHI
• Pfam ID: PF07654
• Sequence:
  MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLL
  KNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
• Function: Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system. Exogenously applied M.tuberculosis EsxA or EsxA-EsxB (or EsxA expressed in host) binds B2M and decreases its export to the cell surface (total protein levels do not change), probably leading to defects in class I antigen presentation.
• KEGG Pathway:
  Antigen processing and presentation (hsa04612)
  Human cytomegalovirus infection (hsa05163)
  Human T-cell leukemia virus 1 infection (hsa05166)
  Herpes simplex virus 1 infection (hsa05168)
  Epstein-Barr virus infection (hsa05169)
  Human immunodeficiency virus 1 infection (hsa05170)
• Reactome Pathway:
  Endosomal/Vacuolar pathway (R-HSA-1236977)
  Nef mediated downregulation of MHC class I complex cell surface expression (R-HSA-164940)
  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933)
  DAP12 interactions (R-HSA-2172127)
  DAP12 signaling (R-HSA-2424491)
  Neutrophil degranulation (R-HSA-6798695)
  Interferon gamma signaling (R-HSA-877300)
  Modulation by Mtb of host immune system (R-HSA-9637628)
  SARS-CoV-2 activates/modulates innate and adaptive immune responses (R-HSA-9705671)
  Amyloid fiber formation (R-HSA-977225)
  Antigen Presentation (R-HSA-983170)
  ER-Phagosome pathway (R-HSA-1236974)

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hypoproteinemia, hypercatabolic	DISFKY61	Strong	Autosomal recessive	[1]
MHC class I deficiency	DISSMWCT	Supportive	Autosomal recessive	[2]
Variant ABeta2M amyloidosis	DISEZK63	Supportive	Autosomal dominant	[3]
Familial visceral amyloidosis	DIS7BVSW	Limited	Autosomal dominant	[3]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Carbamazepine	DMZOLBI	Approved	Beta-2-microglobulin (B2M) increases the Renal impairment ADR of Carbamazepine.	[42]
Menadione	DMSJDTY	Approved	Beta-2-microglobulin (B2M) increases the Investigations ADR of Menadione.	[42]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Beta-2-microglobulin (B2M).	[4]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Beta-2-microglobulin (B2M).	[30]

37 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Beta-2-microglobulin (B2M).	[5]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Beta-2-microglobulin (B2M).	[6]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Beta-2-microglobulin (B2M).	[7]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Beta-2-microglobulin (B2M).	[8]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Beta-2-microglobulin (B2M).	[9]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Beta-2-microglobulin (B2M).	[10]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of Beta-2-microglobulin (B2M).	[11]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Beta-2-microglobulin (B2M).	[12]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Beta-2-microglobulin (B2M).	[13]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Beta-2-microglobulin (B2M).	[14]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Beta-2-microglobulin (B2M).	[15]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Beta-2-microglobulin (B2M).	[16]
Folic acid	DMEMBJC	Approved	Folic acid affects the expression of Beta-2-microglobulin (B2M).	[17]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of Beta-2-microglobulin (B2M).	[18]
Cytarabine	DMZD5QR	Approved	Cytarabine increases the expression of Beta-2-microglobulin (B2M).	[19]
Aspirin	DM672AH	Approved	Aspirin increases the expression of Beta-2-microglobulin (B2M).	[20]
Ifosfamide	DMCT3I8	Approved	Ifosfamide increases the expression of Beta-2-microglobulin (B2M).	[21]
Nitric Oxide	DM1RBYG	Approved	Nitric Oxide increases the expression of Beta-2-microglobulin (B2M).	[22]
Gentamicin	DMKINJO	Approved	Gentamicin increases the expression of Beta-2-microglobulin (B2M).	[23]
Gallium nitrate	DMF9O6B	Approved	Gallium nitrate decreases the expression of Beta-2-microglobulin (B2M).	[24]
Atenolol	DMNKG1Z	Approved	Atenolol decreases the expression of Beta-2-microglobulin (B2M).	[25]
Pamidronate	DMB4AVP	Approved	Pamidronate decreases the expression of Beta-2-microglobulin (B2M).	[26]
Tobramycin	DMUI0CH	Approved	Tobramycin increases the expression of Beta-2-microglobulin (B2M).	[23]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Beta-2-microglobulin (B2M).	[27]
Glyceryl trinitrate	DMF72W3	Phase 4	Glyceryl trinitrate affects the expression of Beta-2-microglobulin (B2M).	[28]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Beta-2-microglobulin (B2M).	[14]
Napabucasin	DMDZ6Q3	Phase 3	Napabucasin decreases the expression of Beta-2-microglobulin (B2M).	[29]
Eugenol	DM7US1H	Patented	Eugenol increases the expression of Beta-2-microglobulin (B2M).	[31]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Beta-2-microglobulin (B2M).	[32]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Beta-2-microglobulin (B2M).	[33]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Beta-2-microglobulin (B2M).	[34]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Beta-2-microglobulin (B2M).	[35]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Beta-2-microglobulin (B2M).	[36]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate increases the expression of Beta-2-microglobulin (B2M).	[37]
GALLICACID	DM6Y3A0	Investigative	GALLICACID decreases the expression of Beta-2-microglobulin (B2M).	[38]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone increases the expression of Beta-2-microglobulin (B2M).	[39]
muramyl dipeptide	DM4FR71	Investigative	muramyl dipeptide increases the activity of Beta-2-microglobulin (B2M).	[41]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Butanoic acid	DMTAJP7	Investigative	Butanoic acid decreases the stability of Beta-2-microglobulin (B2M).	[40]

References

• [1] Familial hypercatabolic hypoproteinemia caused by deficiency of the neonatal Fc receptor, FcRn, due to a mutant beta2-microglobulin gene. Proc Natl Acad Sci U S A. 2006 Mar 28;103(13):5084-9. doi: 10.1073/pnas.0600548103. Epub 2006 Mar 20.
• [2] 2-Microglobulin deficiency causes a complex immunodeficiency of the innate and adaptive immune system. J Allergy Clin Immunol. 2015 Aug;136(2):392-401. doi: 10.1016/j.jaci.2014.12.1937. Epub 2015 Feb 19.
• [3] Hereditary systemic amyloidosis due to Asp76Asn variant 2-microglobulin. N Engl J Med. 2012 Jun 14;366(24):2276-83. doi: 10.1056/NEJMoa1201356.
• [4] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [5] Pharmacogenomic analysis of acute promyelocytic leukemia cells highlights CYP26 cytochrome metabolism in differential all-trans retinoic acid sensitivity. Blood. 2007 May 15;109(10):4450-60.
• [6] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [7] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [8] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [9] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [10] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [11] Health effects and arsenic species in urine of copper smelter workers. J Environ Sci Health A Tox Hazard Subst Environ Eng. 2014;49(7):787-97. doi: 10.1080/10934529.2014.882207.
• [12] Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
• [13] Changes of bone markers during long-term intravenous calcitriol therapy in maintenance dialysis patients. Miner Electrolyte Metab. 1996;22(4):219-23.
• [14] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [15] Synergistic effect of trichostatin A and 5-aza-2'-deoxycytidine on growth inhibition of pancreatic endocrine tumour cell lines: a proteomic study. Proteomics. 2009 Apr;9(7):1952-66. doi: 10.1002/pmic.200701089.
• [16] Subacute myelopathy: an unusual paraneoplastic complication of Hodgkin's disease. Med Pediatr Oncol. 1988;16(4):284-6. doi: 10.1002/mpo.2950160413.
• [17] High folic acid increases cell turnover and lowers differentiation and iron content in human HT29 colon cancer cells. Br J Nutr. 2008 Apr;99(4):703-8.
• [18] [Salvage therapy with proteasome inhibitor bortezomib for relapsed and refractory multiple myeloma]. Zhongguo Shi Yan Xue Ye Xue Za Zhi. 2006 Dec;14(6):1146-50.
• [19] Cytosine arabinoside induced acute interstitial nephritis in a patient treated for refractory anemia with excess of blasts in transformation. Nephron. 2000 Nov;86(3):356-7. doi: 10.1159/000045798.
• [20] Effects of aspirin on metastasis-associated gene expression detected by cDNA microarray. Acta Pharmacol Sin. 2004 Oct;25(10):1327-33.
• [21] A prospective evaluation of ifosfamide-related nephrotoxicity in children and young adults. Cancer. 1995 Dec 15;76(12):2557-64. doi: 10.1002/1097-0142(19951215)76:12<2557::aid-cncr2820761223>3.0.co;2-9.
• [22] Serum clara-cell protein and beta2-microglobulin as early markers of occupational exposure to nitric oxides. Inhal Toxicol. 2005 Feb;17(2):87-97. doi: 10.1080/08958370590899460.
• [23] The absence of nephrotoxicity and differential nephrotoxicity between tobramycin and gentamicin. South Med J. 1990 Oct;83(10):1149-52. doi: 10.1097/00007611-199010000-00008.
• [24] Role of oxidative stress in the induction of metallothionein-2A and heme oxygenase-1 gene expression by the antineoplastic agent gallium nitrate in human lymphoma cells. Free Radic Biol Med. 2008 Sep 15;45(6):763-72.
• [25] A 1-year follow-up study on the effect of atenolol on serum beta 2-microglobulin level in hypertensive diabetic patients. J Int Med Res. 1989 Mar-Apr;17(2):162-7. doi: 10.1177/030006058901700208.
• [26] Pamidronate increases markers of bone formation in patients with multiple myeloma in plateau phase under interferon-alpha treatment. Calcif Tissue Int. 2001 May;68(5):285-90.
• [27] 6-(3,4-Dihydro-1H-isoquinoline-2-yl)-N-(6-methoxypyridine-2-yl) nicotinamide-26 (DIMN-26) decreases cell proliferation by induction of apoptosis and downregulation of androgen receptor signaling in human prostate cancer cells. Chem Biol Interact. 2016 Dec 25;260:196-207. doi: 10.1016/j.cbi.2016.10.008. Epub 2016 Oct 5.
• [28] [Evaluation of the renal function during hypotensive anesthesia induced by nitroglycerin, prostaglandin E1 or nitroglycerin+prostaglandin E1]. Masui. 1993 Jul;42(7):1009-12.
• [29] Suppression of cancer relapse and metastasis by inhibiting cancer stemness. Proc Natl Acad Sci U S A. 2015 Feb 10;112(6):1839-44. doi: 10.1073/pnas.1424171112. Epub 2015 Jan 20.
• [30] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [31] Chemicals with weak skin sensitizing properties can be identified using low-density microarrays on immature dendritic cells. Toxicol Lett. 2007 Nov 1;174(1-3):98-109. doi: 10.1016/j.toxlet.2007.08.015. Epub 2007 Sep 5.
• [32] Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.
• [33] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [34] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [35] Molecular targets of chloropicrin in human airway epithelial cells. Toxicol In Vitro. 2017 Aug;42:247-254.
• [36] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [37] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [38] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.
• [39] 17beta-Estradiol differentially regulates androgen-responsive genes through estrogen receptor-beta- and extracellular-signal regulated kinase-dependent pathways in LNCaP human prostate cancer cells. Mol Carcinog. 2007 Feb;46(2):117-29. doi: 10.1002/mc.20254.
• [40] Enhancement by theophylline of the butyrate-mediated induction of choriogonadotropin alpha-subunit in HeLa cells. II. Effect of both agents on mRNA turnover. Arch Biochem Biophys. 1990 Jul;280(1):95-102. doi: 10.1016/0003-9861(90)90523-2.
• [41] Dendritic cell maturation induced by muramyl dipeptide (MDP) derivatives: monoacylated MDP confers TLR2/TLR4 activation. J Immunol. 2005 Jun 1;174(11):7096-103. doi: 10.4049/jimmunol.174.11.7096.
• [42] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.