General Information of Drug Off-Target (DOT) (ID: OTGZUJ0I)

DOT Name Unconventional myosin-Ib (MYO1B)
Synonyms MYH-1c; Myosin I alpha; MMI-alpha; MMIa
Gene Name MYO1B
Related Disease
Cervical cancer ( )
Cervical carcinoma ( )
Cervical Intraepithelial neoplasia ( )
Esophageal squamous cell carcinoma ( )
Glioma ( )
Head-neck squamous cell carcinoma ( )
Neoplasm ( )
Oral cancer ( )
Prostate cancer ( )
Prostate carcinoma ( )
Advanced cancer ( )
Toxoplasmosis ( )
Tuberous sclerosis ( )
Type-1 diabetes ( )
UniProt ID
MYO1B_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00612 ; PF00063 ; PF06017
Sequence
MAKMEVKTSLLDNMIGVGDMVLLEPLNEETFINNLKKRFDHSEIYTYIGSVVISVNPYRS
LPIYSPEKVEEYRNRNFYELSPHIFALSDEAYRSLRDQDKDQCILITGESGAGKTEASKL
VMSYVAAVCGKGAEVNQVKEQLLQSNPVLEAFGNAKTVRNDNSSRFGKYMDIEFDFKGDP
LGGVISNYLLEKSRVVKQPRGERNFHVFYQLLSGASEELLNKLKLERDFSRYNYLSLDSA
KVNGVDDAANFRTVRNAMQIVGFMDHEAESVLAVVAAVLKLGNIEFKPESRVNGLDESKI
KDKNELKEICELTGIDQSVLERAFSFRTVEAKQEKVSTTLNVAQAYYARDALAKNLYSRL
FSWLVNRINESIKAQTKVRKKVMGVLDIYGFEIFEDNSFEQFIINYCNEKLQQIFIELTL
KEEQEEYIREDIEWTHIDYFNNAIICDLIENNTNGILAMLDEECLRPGTVTDETFLEKLN
QVCATHQHFESRMSKCSRFLNDTSLPHSCFRIQHYAGKVLYQVEGFVDKNNDLLYRDLSQ
AMWKASHALIKSLFPEGNPAKINLKRPPTAGSQFKASVATLMKNLQTKNPNYIRCIKPND
KKAAHIFNEALVCHQIRYLGLLENVRVRRAGYAFRQAYEPCLERYKMLCKQTWPHWKGPA
RSGVEVLFNELEIPVEEYSFGRSKIFIRNPRTLFKLEDLRKQRLEDLATLIQKIYRGWKC
RTHFLLMKKSQIVIAAWYRRYAQQKRYQQTKSSALVIQSYIRGWKARKILRELKHQKRCK
EAVTTIAAYWHGTQARRELRRLKEEARNKHAIAVIWAYWLGSKARRELKRLKEEARRKHA
VAVIWAYWLGLKVRREYRKFFRANAGKKIYEFTLQRIVQKYFLEMKNKMPSLSPIDKNWP
SRPYLFLDSTHKELKRIFHLWRCKKYRDQFTDQQKLIYEEKLEASELFKDKKALYPSSVG
QPFQGAYLEINKNPKYKKLKDAIEEKIIIAEVVNKINRANGKSTSRIFLLTNNNLLLADQ
KSGQIKSEVPLVDVTKVSMSSQNDGFFAVHLKEGSEAASKGDFLFSSDHLIEMATKLYRT
TLSQTKQKLNIEISDEFLVQFRQDKVCVKFIQGNQKNGSVPTCKRKNNRLLEVAVP
Function Motor protein that may participate in process critical to neuronal development and function such as cell migration, neurite outgrowth and vesicular transport.
KEGG Pathway
Motor proteins (hsa04814 )
Pathogenic Escherichia coli infection (hsa05130 )

Molecular Interaction Atlas (MIA) of This DOT

14 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Cervical cancer DISFSHPF Strong Altered Expression [1]
Cervical carcinoma DIST4S00 Strong Altered Expression [1]
Cervical Intraepithelial neoplasia DISXP757 Strong Altered Expression [1]
Esophageal squamous cell carcinoma DIS5N2GV Strong Biomarker [2]
Glioma DIS5RPEH Strong Biomarker [3]
Head-neck squamous cell carcinoma DISF7P24 Strong Biomarker [4]
Neoplasm DISZKGEW Strong Altered Expression [1]
Oral cancer DISLD42D Strong Altered Expression [5]
Prostate cancer DISF190Y Strong Biomarker [1]
Prostate carcinoma DISMJPLE Strong Biomarker [1]
Advanced cancer DISAT1Z9 Limited Altered Expression [6]
Toxoplasmosis DISYP8FH Limited Biomarker [7]
Tuberous sclerosis DISEMUGZ Limited Biomarker [8]
Type-1 diabetes DIS7HLUB Limited Genetic Variation [9]
------------------------------------------------------------------------------------
⏷ Show the Full List of 14 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
25 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Unconventional myosin-Ib (MYO1B). [10]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Unconventional myosin-Ib (MYO1B). [11]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Unconventional myosin-Ib (MYO1B). [12]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Unconventional myosin-Ib (MYO1B). [13]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Unconventional myosin-Ib (MYO1B). [14]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Unconventional myosin-Ib (MYO1B). [15]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Unconventional myosin-Ib (MYO1B). [16]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Unconventional myosin-Ib (MYO1B). [17]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Unconventional myosin-Ib (MYO1B). [18]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Unconventional myosin-Ib (MYO1B). [19]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Unconventional myosin-Ib (MYO1B). [20]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Unconventional myosin-Ib (MYO1B). [21]
Progesterone DMUY35B Approved Progesterone decreases the expression of Unconventional myosin-Ib (MYO1B). [22]
Malathion DMXZ84M Approved Malathion increases the expression of Unconventional myosin-Ib (MYO1B). [23]
Melphalan DMOLNHF Approved Melphalan decreases the expression of Unconventional myosin-Ib (MYO1B). [24]
Enzalutamide DMGL19D Approved Enzalutamide decreases the expression of Unconventional myosin-Ib (MYO1B). [25]
Dihydrotestosterone DM3S8XC Phase 4 Dihydrotestosterone increases the expression of Unconventional myosin-Ib (MYO1B). [25]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Unconventional myosin-Ib (MYO1B). [26]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Unconventional myosin-Ib (MYO1B). [28]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Unconventional myosin-Ib (MYO1B). [31]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Unconventional myosin-Ib (MYO1B). [32]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Unconventional myosin-Ib (MYO1B). [33]
Coumestrol DM40TBU Investigative Coumestrol decreases the expression of Unconventional myosin-Ib (MYO1B). [34]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A decreases the expression of Unconventional myosin-Ib (MYO1B). [35]
GALLICACID DM6Y3A0 Investigative GALLICACID increases the expression of Unconventional myosin-Ib (MYO1B). [36]
------------------------------------------------------------------------------------
⏷ Show the Full List of 25 Drug(s)
1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
DNCB DMDTVYC Phase 2 DNCB affects the binding of Unconventional myosin-Ib (MYO1B). [27]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
TAK-243 DM4GKV2 Phase 1 TAK-243 decreases the sumoylation of Unconventional myosin-Ib (MYO1B). [29]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the methylation of Unconventional myosin-Ib (MYO1B). [30]
------------------------------------------------------------------------------------

References

1 Myosin 1b promotes cell proliferation, migration, and invasion in cervical cancer.Gynecol Oncol. 2018 Apr;149(1):188-197. doi: 10.1016/j.ygyno.2018.01.024. Epub 2018 Feb 1.
2 Molecular pathogenesis of esophageal squamous cell carcinoma: Identification of the antitumor effects of miR?45?p on gene regulation.Int J Oncol. 2019 Feb;54(2):673-688. doi: 10.3892/ijo.2018.4657. Epub 2018 Dec 6.
3 Splicing factor SRSF1 promotes gliomagenesis via oncogenic splice-switching of MYO1B.J Clin Invest. 2019 Feb 1;129(2):676-693. doi: 10.1172/JCI120279. Epub 2019 Jan 14.
4 Passenger strand of miR-145-3p acts as a tumor-suppressor by targeting MYO1B in head and neck squamous cell carcinoma.Int J Oncol. 2018 Jan;52(1):166-178. doi: 10.3892/ijo.2017.4190. Epub 2017 Nov 6.
5 Aberrant Myosin 1b Expression Promotes Cell Migration and Lymph Node Metastasis of HNSCC.Mol Cancer Res. 2015 Apr;13(4):721-31. doi: 10.1158/1541-7786.MCR-14-0410. Epub 2014 Nov 24.
6 Exosomes Derived from Human Primary and Metastatic Colorectal Cancer Cells Contribute to Functional Heterogeneity of Activated Fibroblasts by Reprogramming Their Proteome.Proteomics. 2019 Apr;19(8):e1800148. doi: 10.1002/pmic.201800148. Epub 2019 Jan 31.
7 The Virulence-Related MYR1 Protein of Toxoplasma gondii as a Novel DNA Vaccine Against Toxoplasmosis in Mice.Front Microbiol. 2019 Apr 9;10:734. doi: 10.3389/fmicb.2019.00734. eCollection 2019.
8 Arginase-II activates mTORC1 through myosin-1b in vascular cell senescence and apoptosis.Cell Death Dis. 2018 Feb 22;9(3):313. doi: 10.1038/s41419-018-0356-9.
9 Identification of novel type 1 diabetes candidate genes by integrating genome-wide association data, protein-protein interactions, and human pancreatic islet gene expression.Diabetes. 2012 Apr;61(4):954-62. doi: 10.2337/db11-1263. Epub 2012 Feb 16.
10 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
11 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
12 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
13 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
14 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
15 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
16 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
17 Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
18 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
19 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
20 Role of NADPH oxidase in arsenic-induced reactive oxygen species formation and cytotoxicity in myeloid leukemia cells. Proc Natl Acad Sci U S A. 2004 Mar 30;101(13):4578-83.
21 Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
22 Unique transcriptome, pathways, and networks in the human endometrial fibroblast response to progesterone in endometriosis. Biol Reprod. 2011 Apr;84(4):801-15.
23 Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
24 Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
25 LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
26 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
27 Proteomic analysis of the cellular response to a potent sensitiser unveils the dynamics of haptenation in living cells. Toxicology. 2020 Dec 1;445:152603. doi: 10.1016/j.tox.2020.152603. Epub 2020 Sep 28.
28 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
29 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
30 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
31 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
32 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
33 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
34 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
35 Persistence of epigenomic effects after recovery from repeated treatment with two nephrocarcinogens. Front Genet. 2018 Dec 3;9:558.
36 Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.