General Information of Drug Off-Target (DOT) (ID: OTHL2O08)

DOT Name Myotubularin-related protein 11 (MTMR11)
Synonyms Cisplatin resistance-associated protein; hCRA; Inactive phosphatidylinositol 3-phosphatase 11
Gene Name MTMR11
Related Disease
Hyperglycemia ( )
Advanced cancer ( )
Breast carcinoma ( )
Central retinal vein occlusion ( )
Chromosomal disorder ( )
Colorectal adenoma ( )
Colorectal carcinoma ( )
Head and neck cancer ( )
Head and neck carcinoma ( )
Neoplasm ( )
Non-alcoholic fatty liver disease ( )
Obesity ( )
Cardiac arrest ( )
Rhabdomyosarcoma ( )
Ventricular fibrillation ( )
Ventricular tachycardia ( )
UniProt ID
MTMRB_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF12578 ; PF06602
Sequence
MWWGGRGQSFNIAPQKEEPEMGSVQENRMPEPRSRQPSSCLASRCLPGEQILAWAPGVRK
GLEPELSGTLICTNFRVTFQPCGWQWNQDTPLNSEYDFALVNIGRLEAVSGLSRVQLLRP
GSLHKFIPEEILIHGRDFRLLRVGFEAGGLEPQAFQVTMAIVQARAQSNQAQQYSGITLS
KAGQGSGSRKPPIPLMETAEDWETERKKQAARGWRVSTVNERFDVATSLPRYFWVPNRIL
DSEVRRAFGHFHQGRGPRLSWHHPGGSDLLRCGGFYTASDPNKEDIRAVELMLQAGHSDV
VLVDTMDELPSLADVQLAHLRLRALCLPDSSVAEDKWLSALEGTRWLDYVRACLRKASDI
SVLVTSRVRSVILQERGDRDLNGLLSSLVQLLSAPEARTLFGFQSLVQREWVAAGHPFLT
RLGGTGASEEAPVFLLFLDCVWQLLQQFPADFEFSEFFLLALHDSVRVPDTLTFLRNTPW
ERGKQSGQLNSYTQVYTPGYSQPPAGNSFNLQLSVWDWDLRYSNAQILQFQNPGYDPEHC
PDSWLPRPQPSFMVPGPPSSVWLFSRGALTPLNQLCPWRDSPSLLAVSSRWLPRPAISSE
SLADQEWGLPSHWGACPLPPGLLLPGYLGPQIRLWRRCYLRGRPEVQMGLSAPTISGLQD
ELSHLQELLRKWTPRISPEDHSKKRDPHTILNPTEIAGILKGRAEGDLG
Tissue Specificity Expressed in bone marrow, spleen and thymus.

Molecular Interaction Atlas (MIA) of This DOT

16 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Hyperglycemia DIS0BZB5 Definitive Biomarker [1]
Advanced cancer DISAT1Z9 Strong Genetic Variation [2]
Breast carcinoma DIS2UE88 Strong Genetic Variation [3]
Central retinal vein occlusion DIS5ICKE Strong Biomarker [4]
Chromosomal disorder DISM5BB5 Strong Biomarker [5]
Colorectal adenoma DISTSVHM Strong Biomarker [2]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [6]
Head and neck cancer DISBPSQZ Strong Genetic Variation [7]
Head and neck carcinoma DISOU1DS Strong Genetic Variation [7]
Neoplasm DISZKGEW Strong Genetic Variation [8]
Non-alcoholic fatty liver disease DISDG1NL Strong Biomarker [2]
Obesity DIS47Y1K Strong Biomarker [9]
Cardiac arrest DIS9DIA4 moderate Biomarker [10]
Rhabdomyosarcoma DISNR7MS moderate Biomarker [11]
Ventricular fibrillation DIS7IN76 moderate Biomarker [10]
Ventricular tachycardia DISIBXJ3 moderate Genetic Variation [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 16 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
15 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Myotubularin-related protein 11 (MTMR11). [12]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Myotubularin-related protein 11 (MTMR11). [13]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Myotubularin-related protein 11 (MTMR11). [14]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Myotubularin-related protein 11 (MTMR11). [15]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Myotubularin-related protein 11 (MTMR11). [16]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Myotubularin-related protein 11 (MTMR11). [17]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Myotubularin-related protein 11 (MTMR11). [18]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Myotubularin-related protein 11 (MTMR11). [19]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Myotubularin-related protein 11 (MTMR11). [20]
Rosiglitazone DMILWZR Approved Rosiglitazone decreases the expression of Myotubularin-related protein 11 (MTMR11). [21]
Dihydrotestosterone DM3S8XC Phase 4 Dihydrotestosterone increases the expression of Myotubularin-related protein 11 (MTMR11). [22]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Myotubularin-related protein 11 (MTMR11). [23]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Myotubularin-related protein 11 (MTMR11). [24]
Sulforaphane DMQY3L0 Investigative Sulforaphane decreases the expression of Myotubularin-related protein 11 (MTMR11). [25]
Acetaldehyde DMJFKG4 Investigative Acetaldehyde decreases the expression of Myotubularin-related protein 11 (MTMR11). [26]
------------------------------------------------------------------------------------
⏷ Show the Full List of 15 Drug(s)

References

1 Increase in insulin sensitivity by the association of chicoric acid and chlorogenic acid contained in a natural chicoric acid extract (NCRAE) of chicory (Cichorium intybus L.) for an antidiabetic effect.J Ethnopharmacol. 2018 Apr 6;215:241-248. doi: 10.1016/j.jep.2017.12.035. Epub 2018 Jan 9.
2 The association between nonalcoholic fatty liver disease and risk of colorectal adenoma and cancer incident and recurrence: a meta-analysis of observational studies.Expert Rev Gastroenterol Hepatol. 2019 Apr;13(4):385-395. doi: 10.1080/17474124.2019.1580143. Epub 2019 Feb 19.
3 Association analysis identifies 65 new breast cancer risk loci.Nature. 2017 Nov 2;551(7678):92-94. doi: 10.1038/nature24284. Epub 2017 Oct 23.
4 Two-Year Efficacy of Ranibizumab Plus Laser-Induced Chorioretinal Anastomosis vs Ranibizumab Monotherapy for Central Retinal Vein Occlusion: A Randomized Clinical Trial.JAMA Ophthalmol. 2018 Dec 1;136(12):1391-1397. doi: 10.1001/jamaophthalmol.2018.4973.
5 13-cis retinoic acid treatment for myelodysplastic syndromes.J Clin Oncol. 1986 Apr;4(4):589-95. doi: 10.1200/JCO.1986.4.4.589.
6 Clinical value of an adenosine triphosphate-based chemotherapy response assay in resectable stage III colorectal cancer.Ann Surg Treat Res. 2019 Aug;97(2):93-102. doi: 10.4174/astr.2019.97.2.93. Epub 2019 Jul 29.
7 Wee-1 kinase inhibition overcomes cisplatin resistance associated with high-risk TP53 mutations in head and neck cancer through mitotic arrest followed by senescence.Mol Cancer Ther. 2015 Feb;14(2):608-19. doi: 10.1158/1535-7163.MCT-14-0735-T. Epub 2014 Dec 10.
8 Double-blind, randomized phase 3 trial of low-dose 13-cis retinoic acid in the prevention of second primaries in head and neck cancer: Long-term follow-up of a trial of the Eastern Cooperative Oncology Group-ACRIN Cancer Research Group (C0590).Cancer. 2017 Dec 1;123(23):4653-4662. doi: 10.1002/cncr.30920. Epub 2017 Aug 7.
9 Impact of Different Estimation Methods on Obesity-Attributable Mortality Levels and Trends: The Case of The Netherlands.Int J Environ Res Public Health. 2018 Sep 29;15(10):2146. doi: 10.3390/ijerph15102146.
10 Postanoxic alpha, theta or alpha-theta coma: Clinical setting and neurological outcome.Resuscitation. 2018 Mar;124:118-125. doi: 10.1016/j.resuscitation.2017.12.022. Epub 2017 Dec 22.
11 Survivin-responsive conditionally replicating adenovirus kills rhabdomyosarcoma stem cells more efficiently than their progeny.J Transl Med. 2014 Jan 27;12:27. doi: 10.1186/1479-5876-12-27.
12 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
13 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
14 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
15 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
16 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
17 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
18 A comprehensive analysis of Wnt/beta-catenin signaling pathway-related genes and crosstalk pathways in the treatment of As2O3 in renal cancer. Ren Fail. 2018 Nov;40(1):331-339.
19 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
20 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
21 Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
22 LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
23 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
24 Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
25 Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
26 Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.