Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHRGLCQ)

• DOT Name: Kinesin-like protein KIF11 (KIF11)
• Synonyms: Kinesin-like protein 1; Kinesin-like spindle protein HKSP; Kinesin-related motor protein Eg5; Thyroid receptor-interacting protein 5; TR-interacting protein 5; TRIP-5
• Gene Name: KIF11
• Related Disease: Microcephaly with or without chorioretinopathy, lymphedema, or intellectual disability
• UniProt ID: KIF11_HUMAN
• PDB ID: 1II6 ; 1Q0B ; 1X88 ; 1YRS ; 2FKY ; 2FL2 ; 2FL6 ; 2FME ; 2G1Q ; 2GM1 ; 2IEH ; 2PG2 ; 2Q2Y ; 2Q2Z ; 2UYI ; 2UYM ; 2WOG ; 2X2R ; 2X7C ; 2X7D ; 2X7E ; 2XAE ; 3CJO ; 3HQD ; 3K3B ; 3K5E ; 3KEN ; 3L9H ; 3WPN ; 3ZCW ; 4A1Z ; 4A28 ; 4A50 ; 4A51 ; 4A5Y ; 4AP0 ; 4AQV ; 4AQW ; 4AS7 ; 4B7B ; 4BBG ; 4BXN ; 4CK5 ; 4CK6 ; 4CK7 ; 4ZCA ; 4ZHI ; 5JV3 ; 5ZO7 ; 5ZO8 ; 5ZO9 ; 6G6Y ; 6G6Z ; 6HKX ; 6HKY ; 6TA3 ; 6TA4 ; 6TIW ; 6TLE ; 6TRL ; 6Y1I
• Pfam ID: PF00225 ; PF13931
• Sequence:
  MASQPNSSAKKKEEKGKNIQVVVRCRPFNLAERKASAHSIVECDPVRKEVSVRTGGLADK
  SSRKTYTFDMVFGASTKQIDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERS
  PNEEYTWEEDPLAGIIPRTLHQIFEKLTDNGTEFSVKVSLLEIYNEELFDLLNPSSDVSE
  RLQMFDDPRNKRGVIIKGLEEITVHNKDEVYQILEKGAAKRTTAATLMNAYSSRSHSVFS
  VTIHMKETTIDGEELVKIGKLNLVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRVIT
  ALVERTPHVPYRESKLTRILQDSLGGRTRTSIIATISPASLNLEETLSTLEYAHRAKNIL
  NKPEVNQKLTKKALIKEYTEEIERLKRDLAAAREKNGVYISEENFRVMSGKLTVQEEQIV
  ELIEKIGAVEEELNRVTELFMDNKNELDQCKSDLQNKTQELETTQKHLQETKLQLVKEEY
  ITSALESTEEKLHDAASKLLNTVEETTKDVSGLHSKLDRKKAVDQHNAEAQDIFGKNLNS
  LFNNMEELIKDGSSKQKAMLEVHKTLFGNLLSSSVSALDTITTVALGSLTSIPENVSTHV
  SQIFNMILKEQSLAAESKTVLQELINVLKTDLLSSLEMILSPTVVSILKINSQLKHIFKT
  SLTVADKIEDQKKELDGFLSILCNNLHELQENTICSLVESQKQCGNLTEDLKTIKQTHSQ
  ELCKLMNLWTERFCALEEKCENIQKPLSSVQENIQQKSKDIVNKMTFHSQKFCADSDGFS
  QELRNFNQEGTKLVEESVKHSDKLNGNLEKISQETEQRCESLNTRTVYFSEQWVSSLNER
  EQELHNLLEVVSQCCEASSSDITEKSDGRKAAHEKQHNIFLDQMTIDEDKLIAQNLELNE
  TIKIGLTKLNCFLEQDLKLDIPTGTTPQRKSYLYPSTLVRTEPREHLLDQLKRKQPELLM
  MLNCSENNKEETIPDVDVEEAVLGQYTEEPLSQEPSVDAGVDCSSIGGVPFFQHKKSHGK
  DKENRGINTLERSKVEETTEHLVTKSRLPLRAQINL
• Function: Motor protein required for establishing a bipolar spindle and thus contributing to chromosome congression during mitosis. Required in non-mitotic cells for transport of secretory proteins from the Golgi complex to the cell surface.
• KEGG Pathway: Motor proteins (hsa04814)
• Reactome Pathway:
  COPI-dependent Golgi-to-ER retrograde traffic (R-HSA-6811434)
  Kinesins (R-HSA-983189)
  MHC class II antigen presentation (R-HSA-2132295)

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Microcephaly with or without chorioretinopathy, lymphedema, or intellectual disability	DISFHDE1	Definitive	Autosomal dominant	[1]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Vinblastine	DM5TVS3	Approved	Kinesin-like protein KIF11 (KIF11) affects the response to substance of Vinblastine.	[35]

34 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Kinesin-like protein KIF11 (KIF11).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Kinesin-like protein KIF11 (KIF11).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Kinesin-like protein KIF11 (KIF11).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Kinesin-like protein KIF11 (KIF11).	[5]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Kinesin-like protein KIF11 (KIF11).	[6]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Kinesin-like protein KIF11 (KIF11).	[7]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Kinesin-like protein KIF11 (KIF11).	[8]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Kinesin-like protein KIF11 (KIF11).	[9]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Kinesin-like protein KIF11 (KIF11).	[10]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Kinesin-like protein KIF11 (KIF11).	[11]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Kinesin-like protein KIF11 (KIF11).	[12]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Kinesin-like protein KIF11 (KIF11).	[12]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Kinesin-like protein KIF11 (KIF11).	[13]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Kinesin-like protein KIF11 (KIF11).	[14]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Kinesin-like protein KIF11 (KIF11).	[15]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Kinesin-like protein KIF11 (KIF11).	[16]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Kinesin-like protein KIF11 (KIF11).	[17]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Kinesin-like protein KIF11 (KIF11).	[18]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Kinesin-like protein KIF11 (KIF11).	[19]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of Kinesin-like protein KIF11 (KIF11).	[20]
Palbociclib	DMD7L94	Approved	Palbociclib decreases the expression of Kinesin-like protein KIF11 (KIF11).	[21]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Kinesin-like protein KIF11 (KIF11).	[22]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Kinesin-like protein KIF11 (KIF11).	[9]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Kinesin-like protein KIF11 (KIF11).	[23]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Kinesin-like protein KIF11 (KIF11).	[24]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Kinesin-like protein KIF11 (KIF11).	[25]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Kinesin-like protein KIF11 (KIF11).	[26]
Scriptaid	DM9JZ21	Preclinical	Scriptaid affects the expression of Kinesin-like protein KIF11 (KIF11).	[27]
Nobiletin	DM7R3B6	Preclinical	Nobiletin decreases the expression of Kinesin-like protein KIF11 (KIF11).	[28]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Kinesin-like protein KIF11 (KIF11).	[29]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Kinesin-like protein KIF11 (KIF11).	[30]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Kinesin-like protein KIF11 (KIF11).	[32]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate decreases the expression of Kinesin-like protein KIF11 (KIF11).	[33]
geraniol	DMS3CBD	Investigative	geraniol decreases the expression of Kinesin-like protein KIF11 (KIF11).	[34]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Kinesin-like protein KIF11 (KIF11).	[31]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [3] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [4] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [5] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [6] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [7] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [8] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [9] Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
• [10] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [11] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [12] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [13] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [14] Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
• [15] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [16] Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
• [17] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [18] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [19] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [20] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [21] Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
• [22] Resveratrol-induced gene expression profiles in human prostate cancer cells. Cancer Epidemiol Biomarkers Prev. 2005 Mar;14(3):596-604. doi: 10.1158/1055-9965.EPI-04-0398.
• [23] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [24] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [25] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [26] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [27] Histone deacetylase inhibitor scriptaid induces cell cycle arrest and epigenetic change in colon cancer cells. Int J Oncol. 2008 Oct;33(4):767-76.
• [28] Characteristics of nobiletin-mediated alteration of gene expression in cultured cell lines. Biochem Biophys Res Commun. 2013 Feb 15;431(3):530-4.
• [29] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [30] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [31] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [32] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [33] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [34] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
• [35] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.