Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHSJCRQ)

• DOT Name: Inositol polyphosphate 1-phosphatase (INPP1)
• Synonyms: IPP; IPPase; EC 3.1.3.57
• Gene Name: INPP1
• UniProt ID: INPP_HUMAN
• EC Number: 3.1.3.57
• Pfam ID: PF00459
• Sequence:
  MSDILRELLCVSEKAANIARACRQQEALFQLLIEEKKEGEKNKKFAVDFKTLADVLVQEV
  IKQNMENKFPGLEKNIFGEESNEFTNDWGEKITLRLCSTEEETAELLSKVLNGNKVASEA
  LARVVHQDVAFTDPTLDSTEINVPQDILGIWVDPIDSTYQYIKGSADIKSNQGIFPCGLQ
  CVTILIGVYDIQTGVPLMGVINQPFVSRDPNTLRWKGQCYWGLSYMGTNMHSLQLTISRR
  NGSETHTGNTGSEAAFSPSFSAVISTSEKETIKAALSRVCGDRIFGAAGAGYKSLCVVQG
  LVDIYIFSEDTTFKWDSCAAHAILRAMGGGIVDLKECLERNPETGLDLPQLVYHVENEGA
  AGVDRWANKGGLIAYRSRKRLETFLSLLVQNLAPAETHT
• Function: Mg(2+)-dependent phosphatase that catalyzes the hydrolysis of the 1-position phosphate from inositol 1,4-bisphosphate and inositol 1,3,4-trisphosphate and participates in inositol phosphate metabolism.
• Tissue Specificity: Ubiquitously expressed, with highest levels in pancreas and kidney.
• KEGG Pathway:
  Inositol phosphate metabolism (hsa00562)
  Metabolic pathways (hsa01100)
  Phosphatidylinositol sig.ling system (hsa04070)
• Reactome Pathway: Synthesis of IP2, IP, and Ins in the cytosol (R-HSA-1855183)
• BioCyc Pathway: MetaCyc:HS07761-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic trioxide	DM61TA4	Approved	Inositol polyphosphate 1-phosphatase (INPP1) decreases the response to substance of Arsenic trioxide.	[22]

21 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Inositol polyphosphate 1-phosphatase (INPP1).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Inositol polyphosphate 1-phosphatase (INPP1).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Inositol polyphosphate 1-phosphatase (INPP1).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Inositol polyphosphate 1-phosphatase (INPP1).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate affects the expression of Inositol polyphosphate 1-phosphatase (INPP1).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Inositol polyphosphate 1-phosphatase (INPP1).	[6]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Inositol polyphosphate 1-phosphatase (INPP1).	[7]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Inositol polyphosphate 1-phosphatase (INPP1).	[8]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Inositol polyphosphate 1-phosphatase (INPP1).	[9]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Inositol polyphosphate 1-phosphatase (INPP1).	[10]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Inositol polyphosphate 1-phosphatase (INPP1).	[11]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Inositol polyphosphate 1-phosphatase (INPP1).	[12]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Inositol polyphosphate 1-phosphatase (INPP1).	[13]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of Inositol polyphosphate 1-phosphatase (INPP1).	[14]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Inositol polyphosphate 1-phosphatase (INPP1).	[16]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Inositol polyphosphate 1-phosphatase (INPP1).	[17]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Inositol polyphosphate 1-phosphatase (INPP1).	[18]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Inositol polyphosphate 1-phosphatase (INPP1).	[19]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Inositol polyphosphate 1-phosphatase (INPP1).	[13]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Inositol polyphosphate 1-phosphatase (INPP1).	[20]
Glyphosate	DM0AFY7	Investigative	Glyphosate increases the expression of Inositol polyphosphate 1-phosphatase (INPP1).	[21]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Inositol polyphosphate 1-phosphatase (INPP1).	[15]

References

• [1] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [4] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [7] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [8] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [9] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [10] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [11] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [12] Gene expression profile of human lymphoid CEM cells sensitive and resistant to glucocorticoid-evoked apoptosis. Genomics. 2003 Jun;81(6):543-55.
• [13] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [14] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [15] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [16] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [17] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [18] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
• [19] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [20] Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.
• [21] Alteration of estrogen-regulated gene expression in human cells induced by the agricultural and horticultural herbicide glyphosate. Hum Exp Toxicol. 2007 Sep;26(9):747-52. doi: 10.1177/0960327107083453.
• [22] The NRF2-mediated oxidative stress response pathway is associated with tumor cell resistance to arsenic trioxide across the NCI-60 panel. BMC Med Genomics. 2010 Aug 13;3:37. doi: 10.1186/1755-8794-3-37.