General Information of Drug Off-Target (DOT) (ID: OTOE0Z1R)

DOT Name Mitogen-activated protein kinase kinase kinase 6 (MAP3K6)
Synonyms EC 2.7.11.25; Apoptosis signal-regulating kinase 2
Gene Name MAP3K6
Related Disease
Hereditary diffuse gastric adenocarcinoma ( )
Gastric cancer ( )
UniProt ID
M3K6_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
2.7.11.25
Pfam ID
PF19039 ; PF20309 ; PF20302 ; PF13281 ; PF00069
Sequence
MAGPCPRSGAERAGSCWQDPLAVALSRGRQLAAPPGRGCARSRPLSVVYVLTREPQPGLE
PREGTEAEPLPLRCLREACAQVPRPRPPPQLRSLPFGTLELGDTAALDAFYNADVVVLEV
SSSLVQPSLFYHLGVRESFSMTNNVLLCSQADLPDLQALREDVFQKNSDCVGSYTLIPYV
VTATGRVLCGDAGLLRGLADGLVQAGVGTEALLTPLVGRLARLLEATPTDSCGYFRETIR
RDIRQARERFSGPQLRQELARLQRRLDSVELLSPDIIMNLLLSYRDVQDYSAIIELVETL
QALPTCDVAEQHNVCFHYTFALNRRNRPGDRAKALSVLLPLVQLEGSVAPDLYCMCGRIY
KDMFFSSGFQDAGHREQAYHWYRKAFDVEPSLHSGINAAVLLIAAGQHFEDSKELRLIGM
KLGCLLARKGCVEKMQYYWDVGFYLGAQILANDPTQVVLAAEQLYKLNAPIWYLVSVMET
FLLYQHFRPTPEPPGGPPRRAHFWLHFLLQSCQPFKTACAQGDQCLVLVLEMNKVLLPAK
LEVRGTDPVSTVTLSLLEPETQDIPSSWTFPVASICGVSASKRDERCCFLYALPPAQDVQ
LCFPSVGHCQWFCGLIQAWVTNPDSTAPAEEAEGAGEMLEFDYEYTETGERLVLGKGTYG
VVYAGRDRHTRVRIAIKEIPERDSRFSQPLHEEIALHRRLRHKNIVRYLGSASQGGYLKI
FMEEVPGGSLSSLLRSVWGPLKDNESTISFYTRQILQGLGYLHDNHIVHRDIKGDNVLIN
TFSGLLKISDFGTSKRLAGITPCTETFTGTLQYMAPEIIDQGPRGYGKAADIWSLGCTVI
EMATGRPPFHELGSPQAAMFQVGMYKVHPPMPSSLSAEAQAFLLRTFEPDPRLRASAQTL
LGDPFLQPGKRSRSPSSPRHAPRPSDAPSASPTPSANSTTQSQTFPCPQAPSQHPPSPPK
RCLSYGGTSQLRVPEEPAAEEPASPEESSGLSLLHQESKRRAMLAAVLEQELPALAENLH
QEQKQEQGARLGRNHVEELLRCLGAHIHTPNRRQLAQELRALQGRLRAQGLGPALLHRPL
FAFPDAVKQILRKRQIRPHWMFVLDSLLSRAVRAALGVLGPEVEKEAVSPRSEELSNEGD
SQQSPGQQSPLPVEPEQGPAPLMVQLSLLRAETDRLREILAGKEREYQALVQRALQRLNE
EARTYVLAPEPPTALSTDQGLVQWLQELNVDSGTIQMLLNHSFTLHTLLTYATRDDLIYT
RIRGGMVCRIWRAILAQRAGSTPVTSGP
Function Component of a protein kinase signal transduction cascade. Activates the JNK, but not ERK or p38 kinase pathways.
KEGG Pathway
MAPK sig.ling pathway (hsa04010 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Hereditary diffuse gastric adenocarcinoma DISUIBYS Supportive Autosomal dominant [1]
Gastric cancer DISXGOUK Limited Unknown [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Mitogen-activated protein kinase kinase kinase 6 (MAP3K6). [3]
------------------------------------------------------------------------------------
14 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Mitogen-activated protein kinase kinase kinase 6 (MAP3K6). [4]
Cisplatin DMRHGI9 Approved Cisplatin affects the expression of Mitogen-activated protein kinase kinase kinase 6 (MAP3K6). [5]
Triclosan DMZUR4N Approved Triclosan increases the expression of Mitogen-activated protein kinase kinase kinase 6 (MAP3K6). [6]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Mitogen-activated protein kinase kinase kinase 6 (MAP3K6). [7]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Mitogen-activated protein kinase kinase kinase 6 (MAP3K6). [5]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of Mitogen-activated protein kinase kinase kinase 6 (MAP3K6). [8]
Rosiglitazone DMILWZR Approved Rosiglitazone decreases the expression of Mitogen-activated protein kinase kinase kinase 6 (MAP3K6). [9]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Mitogen-activated protein kinase kinase kinase 6 (MAP3K6). [10]
Dihydrotestosterone DM3S8XC Phase 4 Dihydrotestosterone increases the expression of Mitogen-activated protein kinase kinase kinase 6 (MAP3K6). [11]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Mitogen-activated protein kinase kinase kinase 6 (MAP3K6). [12]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Mitogen-activated protein kinase kinase kinase 6 (MAP3K6). [13]
PMID27336223-Compound-5 DM6E50A Patented PMID27336223-Compound-5 decreases the expression of Mitogen-activated protein kinase kinase kinase 6 (MAP3K6). [9]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Mitogen-activated protein kinase kinase kinase 6 (MAP3K6). [14]
GALLICACID DM6Y3A0 Investigative GALLICACID increases the expression of Mitogen-activated protein kinase kinase kinase 6 (MAP3K6). [15]
------------------------------------------------------------------------------------
⏷ Show the Full List of 14 Drug(s)

References

1 Germline mutations in MAP3K6 are associated with familial gastric cancer. PLoS Genet. 2014 Oct 23;10(10):e1004669. doi: 10.1371/journal.pgen.1004669. eCollection 2014 Oct.
2 The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
5 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
6 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
7 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
8 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
9 PPARgamma controls CD1d expression by turning on retinoic acid synthesis in developing human dendritic cells. J Exp Med. 2006 Oct 2;203(10):2351-62.
10 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
11 LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
12 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
13 New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
14 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
15 Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.