Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRBL3NQ)

• DOT Name: Delta-sarcoglycan (SGCD)
• Synonyms: Delta-SG; 35 kDa dystrophin-associated glycoprotein; 35DAG
• Gene Name: SGCD
• Related Disease:
  Autosomal recessive limb-girdle muscular dystrophy
  Autosomal recessive limb-girdle muscular dystrophy type 2F
  Familial dilated cardiomyopathy
  Age-related macular degeneration
  Autonomic nervous system disorder
  Autosomal recessive limb-girdle muscular dystrophy type 2A
  Cardiac disease
  Chronic obstructive pulmonary disease
  Duchenne muscular dystrophy
  Dysautonomia
  Hypertrophic cardiomyopathy
  Idiopathic cardiomyopathy
  Muscular dystrophy
  Non-insulin dependent diabetes
  Obstructive sleep apnea
  Schizophrenia
  Cardiac failure
  Congenital muscular dystrophy
  Congestive heart failure
  Coronary vasospasm
  Obsolete familial isolated dilated cardiomyopathy
  Dilated cardiomyopathy 1L
  Dilated cardiomyopathy
• UniProt ID: SGCD_HUMAN
• Pfam ID: PF04790
• Sequence:
  MPQEQYTHHRSTMPGSVGPQVYKVGIYGWRKRCLYFFVLLLMILILVNLAMTIWILKVMN
  FTIDGMGNLRITEKGLKLEGDSEFLQPLYAKEIQSRPGNALYFKSARNVTVNILNDQTKV
  LTQLITGPKAVEAYGKKFEVKTVSGKLLFSADNNEVVVGAERLRVLGAEGTVFPKSIETP
  NVRADPFKELRLESPTRSLVMEAPKGVEINAEAGNMEATCRTELRLESKDGEIKLDAAKI
  RLPRLPHGSYTPTGTRQKVFEICVCANGRLFLSQAGAGSTCQINTSVCL
• Function: Component of the sarcoglycan complex, a subcomplex of the dystrophin-glycoprotein complex which forms a link between the F-actin cytoskeleton and the extracellular matrix.
• Tissue Specificity: Most strongly expressed in skeletal and cardiac muscle. Also detected in smooth muscle. Weak expression in brain and lung.
• KEGG Pathway:
  Cytoskeleton in muscle cells (hsa04820)
  Hypertrophic cardiomyopathy (hsa05410)
  Arrhythmogenic right ventricular cardiomyopathy (hsa05412)
  Dilated cardiomyopathy (hsa05414)
  Viral myocarditis (hsa05416)

Molecular Interaction Atlas (MIA) of This DOT

23 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Autosomal recessive limb-girdle muscular dystrophy	DISWPGLM	Definitive	Autosomal recessive	[1]
Autosomal recessive limb-girdle muscular dystrophy type 2F	DISXFDEG	Definitive	Autosomal recessive	[1]
Familial dilated cardiomyopathy	DISBHDU9	Definitive	Genetic Variation	[2]
Age-related macular degeneration	DIS0XS2C	Strong	Genetic Variation	[3]
Autonomic nervous system disorder	DIS6JLTA	Strong	Genetic Variation	[4]
Autosomal recessive limb-girdle muscular dystrophy type 2A	DISIHX4S	Strong	Genetic Variation	[5]
Cardiac disease	DISVO1I5	Strong	Genetic Variation	[6]
Chronic obstructive pulmonary disease	DISQCIRF	Strong	Genetic Variation	[7]
Duchenne muscular dystrophy	DISRQ3NV	Strong	Biomarker	[8]
Dysautonomia	DISF4MT6	Strong	Genetic Variation	[4]
Hypertrophic cardiomyopathy	DISQG2AI	Strong	Genetic Variation	[9]
Idiopathic cardiomyopathy	DISUGBZL	Strong	Biomarker	[10]
Muscular dystrophy	DISJD6P7	Strong	Genetic Variation	[6]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[11]
Obstructive sleep apnea	DIS0SVD1	Strong	Genetic Variation	[12]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[13]
Cardiac failure	DISDC067	moderate	Genetic Variation	[6]
Congenital muscular dystrophy	DISKY7OY	moderate	Biomarker	[14]
Congestive heart failure	DIS32MEA	moderate	Genetic Variation	[6]
Coronary vasospasm	DISSHV10	moderate	Genetic Variation	[9]
Obsolete familial isolated dilated cardiomyopathy	DIS4FXO4	Supportive	Autosomal dominant	[15]
Dilated cardiomyopathy 1L	DISPKF56	Disputed	Autosomal dominant	[16]
Dilated cardiomyopathy	DISX608J	Limited	Autosomal dominant	[1]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Delta-sarcoglycan (SGCD).	[17]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Delta-sarcoglycan (SGCD).	[25]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Delta-sarcoglycan (SGCD).	[28]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Delta-sarcoglycan (SGCD).	[25]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Delta-sarcoglycan (SGCD).	[18]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Delta-sarcoglycan (SGCD).	[19]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Delta-sarcoglycan (SGCD).	[20]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Delta-sarcoglycan (SGCD).	[21]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Delta-sarcoglycan (SGCD).	[22]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Delta-sarcoglycan (SGCD).	[23]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Delta-sarcoglycan (SGCD).	[24]
Permethrin	DMZ0Q1G	Approved	Permethrin decreases the expression of Delta-sarcoglycan (SGCD).	[26]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Delta-sarcoglycan (SGCD).	[27]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Delta-sarcoglycan (SGCD).	[29]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Delta-sarcoglycan (SGCD).	[30]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Delta-sarcoglycan (SGCD).	[22]
cinnamaldehyde	DMZDUXG	Investigative	cinnamaldehyde increases the expression of Delta-sarcoglycan (SGCD).	[31]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Molecular genetics of left ventricular dysfunction.Curr Mol Med. 2001 Mar;1(1):81-90. doi: 10.2174/1566524013364077.
• [3] Lack of Delta-Sarcoglycan (Sgcd) Results in Retinal Degeneration.Int J Mol Sci. 2019 Nov 4;20(21):5480. doi: 10.3390/ijms20215480.
• [4] Autonomic, locomotor and cardiac abnormalities in a mouse model of muscular dystrophy: targeting the renin-angiotensin system.Exp Physiol. 2014 Apr;99(4):627-31. doi: 10.1113/expphysiol.2013.074336. Epub 2013 Dec 13.
• [5] Mutations in the delta-sarcoglycan gene are a rare cause of autosomal recessive limb-girdle muscular dystrophy (LGMD2). Neurogenetics. 1997 May;1(1):49-58. doi: 10.1007/s100480050008.
• [6] Na(+)-H(+) exchanger and proton channel in heart failure associated with Becker and Duchenne muscular dystrophies.Can J Physiol Pharmacol. 2017 Oct;95(10):1213-1223. doi: 10.1139/cjpp-2017-0265. Epub 2017 Jul 20.
• [7] A genome-wide analysis of the response to inhaled 2-agonists in chronic obstructive pulmonary disease.Pharmacogenomics J. 2016 Aug;16(4):326-35. doi: 10.1038/tpj.2015.65. Epub 2015 Oct 27.
• [8] Limb-girdle muscular dystrophy 2C: clinical aspects.Neuromuscul Disord. 1996 Dec;6(6):493-4. doi: 10.1016/s0960-8966(96)00395-1.
• [9] A delta-sarcoglycan gene polymorphism as a risk factor for hypertrophic cardiomyopathy.Genet Test Mol Biomarkers. 2012 Aug;16(8):855-8. doi: 10.1089/gtmb.2011.0343. Epub 2012 Apr 23.
• [10] Hydrogen gas attenuates embryonic gene expression and prevents left ventricular remodeling induced by intermittent hypoxia in cardiomyopathic hamsters.Am J Physiol Heart Circ Physiol. 2014 Dec 1;307(11):H1626-33. doi: 10.1152/ajpheart.00228.2014. Epub 2014 Oct 3.
• [11] Deciphering the scalene association among type-2 diabetes mellitus, prostate cancer, and chronic myeloid leukemia via enrichment analysis of disease-gene network.Cancer Med. 2019 May;8(5):2268-2277. doi: 10.1002/cam4.1845. Epub 2019 Apr 1.
• [12] The CC genotype of the delta-sarcoglycan gene polymorphism rs13170573 is associated with obstructive sleep apnea in the Chinese population.PLoS One. 2014 Dec 4;9(12):e114160. doi: 10.1371/journal.pone.0114160. eCollection 2014.
• [13] Genome-wide association study of paliperidone efficacy.Pharmacogenet Genomics. 2017 Jan;27(1):7-18. doi: 10.1097/FPC.0000000000000250.
• [14] Recent advances in diagnosis of the childhood muscular dystrophies.J Paediatr Child Health. 1997 Jun;33(3):195-201. doi: 10.1111/j.1440-1754.1997.tb01579.x.
• [15] Mutations in the human delta-sarcoglycan gene in familial and sporadic dilated cardiomyopathy. J Clin Invest. 2000 Sep;106(5):655-62. doi: 10.1172/JCI9224.
• [16] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [17] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [18] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [19] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [20] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [21] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [22] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [23] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [24] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [25] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [26] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [27] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [28] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [29] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [30] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [31] Comparative DNA microarray analysis of human monocyte derived dendritic cells and MUTZ-3 cells exposed to the moderate skin sensitizer cinnamaldehyde. Toxicol Appl Pharmacol. 2009 Sep 15;239(3):273-83.