Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTRZ00CH)

DOT Name Arrestin-C (ARR3)
Synonyms Cone arrestin; C-arrestin; cArr; Retinal cone arrestin-3; X-arrestin
Gene Name ARR3
Related Disease
Lymphoma, non-Hodgkin, familial ( )
Non-hodgkin lymphoma ( )
Small lymphocytic lymphoma ( )
Acute lymphocytic leukaemia ( )
Adult glioblastoma ( )
Adult lymphoma ( )
Bladder cancer ( )
Bone osteosarcoma ( )
Brain neoplasm ( )
Carcinoma of liver and intrahepatic biliary tract ( )
Craniosynostosis ( )
Epithelial ovarian cancer ( )
Glioblastoma multiforme ( )
Graft-versus-host disease ( )
Hepatocellular carcinoma ( )
Immunodeficiency ( )
leukaemia ( )
Liver cancer ( )
Lung cancer ( )
Lung carcinoma ( )
Lymphoid leukemia ( )
Lymphoma ( )
Melanoma ( )
Metabolic disorder ( )
Metastatic malignant neoplasm ( )
Myopia 26, X-linked, female-limited ( )
Neuroblastoma ( )
Obesity ( )
Osteosarcoma ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Pediatric lymphoma ( )
Plasma cell myeloma ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
Childhood acute lymphoblastic leukemia ( )
Acute myelogenous leukaemia ( )
B-cell lymphoma ( )
B-cell neoplasm ( )
Colorectal carcinoma ( )
Leukemia ( )
Matthew-Wood syndrome ( )
Retinoblastoma ( )
Triple negative breast cancer ( )
Type-1/2 diabetes ( )
UniProt ID
ARRC_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF02752 ; PF00339
Sequence
MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPEYLKCRKLFVMLTCAFRYG
RDDLEVIGLTFRKDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNL
PCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPS
AQTIRRFLLSAQPLQLQAWMDREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVL
YSLDKYTKTVFIQEFTETVAANSSFSQSFAVTPILAASCQKRGLALDGKLKHEDTNLASS
TIIRPGMDKELLGILVSYKVRVNLMVSCGGILGDLTASDVGVELPLVLIHPKPSHEAASS
EDIVIEEFTRKGEEESQKAVEAEGDEGS
Function May play a role in an as yet undefined retina-specific signal transduction. Could bind to photoactivated-phosphorylated red/green opsins.
Tissue Specificity Inner and outer segments, and the inner plexiform regions of the retina.

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Lymphoma, non-Hodgkin, familial DISCXYIZ Definitive Biomarker [1]
Non-hodgkin lymphoma DISS2Y8A Definitive Biomarker [1]
Small lymphocytic lymphoma DIS30POX Definitive Biomarker [2]
Acute lymphocytic leukaemia DISPX75S Strong Biomarker [3]
Adult glioblastoma DISVP4LU Strong Biomarker [4]
Adult lymphoma DISK8IZR Strong Genetic Variation [5]
Bladder cancer DISUHNM0 Strong Biomarker [6]
Bone osteosarcoma DIST1004 Strong Biomarker [7]
Brain neoplasm DISY3EKS Strong Biomarker [8]
Carcinoma of liver and intrahepatic biliary tract DIS8WA0W Strong Biomarker [9]
Craniosynostosis DIS6J405 Strong Biomarker [10]
Epithelial ovarian cancer DIS56MH2 Strong Biomarker [11]
Glioblastoma multiforme DISK8246 Strong Genetic Variation [12]
Graft-versus-host disease DIS0QADF Strong Biomarker [13]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [14]
Immunodeficiency DIS093I0 Strong Biomarker [15]
leukaemia DISS7D1V Strong Biomarker [16]
Liver cancer DISDE4BI Strong Biomarker [9]
Lung cancer DISCM4YA Strong Altered Expression [17]
Lung carcinoma DISTR26C Strong Altered Expression [17]
Lymphoid leukemia DIS65TYQ Strong Biomarker [18]
Lymphoma DISN6V4S Strong Biomarker [5]
Melanoma DIS1RRCY Strong Biomarker [19]
Metabolic disorder DIS71G5H Strong Biomarker [9]
Metastatic malignant neoplasm DIS86UK6 Strong Biomarker [20]
Myopia 26, X-linked, female-limited DISDOKDT Strong X-linked [21]
Neuroblastoma DISVZBI4 Strong Genetic Variation [22]
Obesity DIS47Y1K Strong Biomarker [23]
Osteosarcoma DISLQ7E2 Strong Biomarker [7]
Ovarian cancer DISZJHAP Strong Biomarker [11]
Ovarian neoplasm DISEAFTY Strong Biomarker [11]
Pediatric lymphoma DIS51BK2 Strong Genetic Variation [5]
Plasma cell myeloma DIS0DFZ0 Strong Biomarker [24]
Urinary bladder cancer DISDV4T7 Strong Biomarker [6]
Urinary bladder neoplasm DIS7HACE Strong Biomarker [6]
Childhood acute lymphoblastic leukemia DISJ5D6U moderate Biomarker [3]
Acute myelogenous leukaemia DISCSPTN Limited Biomarker [25]
B-cell lymphoma DISIH1YQ Limited Biomarker [26]
B-cell neoplasm DISVY326 Limited Biomarker [27]
Colorectal carcinoma DIS5PYL0 Limited Biomarker [28]
Leukemia DISNAKFL Limited Biomarker [29]
Matthew-Wood syndrome DISA7HR7 Limited Biomarker [30]
Retinoblastoma DISVPNPB Limited Altered Expression [31]
Triple negative breast cancer DISAMG6N Limited Biomarker [32]
Type-1/2 diabetes DISIUHAP Limited Biomarker [23]
------------------------------------------------------------------------------------
⏷ Show the Full List of 45 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Paclitaxel DMLB81S Approved Arrestin-C (ARR3) decreases the response to substance of Paclitaxel. [35]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Arrestin-C (ARR3). [33]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Arrestin-C (ARR3). [34]
------------------------------------------------------------------------------------

References

1 Preclinical Evaluation of Allogeneic CAR T Cells Targeting BCMA for the Treatment of Multiple Myeloma.Mol Ther. 2019 Jun 5;27(6):1126-1138. doi: 10.1016/j.ymthe.2019.04.001. Epub 2019 Apr 8.
2 Safety and tolerability of conditioning chemotherapy followed by CD19-targeted CAR T cells for relapsed/refractory CLL.JCI Insight. 2019 Apr 2;5(9):e122627. doi: 10.1172/jci.insight.122627.
3 Cancer immune therapy for lymphoid malignancies: recent advances.Semin Immunopathol. 2019 Jan;41(1):111-124. doi: 10.1007/s00281-018-0696-7. Epub 2018 Jul 13.
4 CAR-Engineered NK Cells for the Treatment of Glioblastoma: Turning Innate Effectors Into Precision Tools for Cancer Immunotherapy.Front Immunol. 2019 Nov 14;10:2683. doi: 10.3389/fimmu.2019.02683. eCollection 2019.
5 Challenges of driving CD30-directed CAR-T cells to the clinic.BMC Cancer. 2019 Mar 6;19(1):203. doi: 10.1186/s12885-019-5415-9.
6 Targeting CD46 Enhances Anti-Tumoral Activity of Adenovirus Type 5 for Bladder Cancer.Int J Mol Sci. 2018 Sep 10;19(9):2694. doi: 10.3390/ijms19092694.
7 Treating osteosarcoma with CAR T cells.Scand J Immunol. 2019 Mar;89(3):e12741. doi: 10.1111/sji.12741. Epub 2019 Jan 15.
8 Regional Delivery of Chimeric Antigen Receptor-Engineered T Cells Effectively Targets HER2(+) Breast Cancer Metastasis to the Brain.Clin Cancer Res. 2018 Jan 1;24(1):95-105. doi: 10.1158/1078-0432.CCR-17-2041. Epub 2017 Oct 23.
9 High-Content Analysis of Constitutive Androstane Receptor Nuclear Translocation.Methods Mol Biol. 2019;1966:71-77. doi: 10.1007/978-1-4939-9195-2_6.
10 Granulocyte-macrophage colony-stimulating factor inactivation in CAR T-cells prevents monocyte-dependent release of key cytokine release syndrome mediators.J Biol Chem. 2019 Apr 5;294(14):5430-5437. doi: 10.1074/jbc.AC119.007558. Epub 2019 Feb 25.
11 Advances Of Chimeric Antigen Receptor T Cell Therapy In Ovarian Cancer.Onco Targets Ther. 2019 Sep 30;12:8015-8022. doi: 10.2147/OTT.S203550. eCollection 2019.
12 Multiparametric magnetic resonance imaging in the assessment of anti-EGFRvIII chimeric antigen receptor T cell therapy in patients with recurrent glioblastoma.Br J Cancer. 2019 Jan;120(1):54-56. doi: 10.1038/s41416-018-0342-0. Epub 2018 Nov 27.
13 Use of chimeric antigen receptor T cells in allogeneic hematopoietic stem cell transplantation.Immunotherapy. 2019 Jan;11(1):37-44. doi: 10.2217/imt-2018-0089.
14 Adoptive cell transfer therapy for hepatocellular carcinoma.Front Med. 2019 Feb;13(1):3-11. doi: 10.1007/s11684-019-0684-x. Epub 2019 Jan 18.
15 Purinergic targeting enhances immunotherapy of CD73(+) solid tumors with piggyBac-engineered chimeric antigen receptor natural killer cells.J Immunother Cancer. 2018 Dec 4;6(1):136. doi: 10.1186/s40425-018-0441-8.
16 Allogeneic CAR T cell therapies for leukemia.Am J Hematol. 2019 May;94(S1):S50-S54. doi: 10.1002/ajh.25399. Epub 2019 Feb 1.
17 Cisplatin Synergistically Enhances Antitumor Potency of Conditionally Replicating Adenovirus via p53 Dependent or Independent Pathways in Human Lung Carcinoma.Int J Mol Sci. 2019 Mar 5;20(5):1125. doi: 10.3390/ijms20051125.
18 Induced CD20 Expression on B-Cell Malignant Cells Heightened the Cytotoxic Activity of Chimeric Antigen Receptor Engineered T Cells.Hum Gene Ther. 2019 Apr;30(4):497-510. doi: 10.1089/hum.2018.119. Epub 2019 Jan 23.
19 Combinatorial Approach to Improve Cancer Immunotherapy: Rational Drug Design Strategy to Simultaneously Hit Multiple Targets to Kill Tumor Cells and to Activate the Immune System.J Oncol. 2019 Feb 3;2019:5245034. doi: 10.1155/2019/5245034. eCollection 2019.
20 Pancreatic cancer therapy with combined mesothelin-redirected chimeric antigen receptor T cells and cytokine-armed oncolytic adenoviruses.JCI Insight. 2018 Apr 5;3(7):e99573. doi: 10.1172/jci.insight.99573. eCollection 2018 Apr 5.
21 X-linked heterozygous mutations in ARR3 cause female-limited early onset high myopia. Mol Vis. 2016 Oct 26;22:1257-1266. eCollection 2016.
22 Efficiency of CAR-T Therapy for Treatment of Solid Tumor in Clinical Trials: A Meta-Analysis.Dis Markers. 2019 Feb 11;2019:3425291. doi: 10.1155/2019/3425291. eCollection 2019.
23 The Role of Xenobiotic Receptors on Hepatic Glycolipid Metabolism.Curr Drug Metab. 2019;20(1):29-35. doi: 10.2174/1389200219666180918152241.
24 Chimeric antigen receptor T cell immunotherapy for multiple myeloma: A review of current data and potential clinical applications.Am J Hematol. 2019 May;94(S1):S28-S33. doi: 10.1002/ajh.25428. Epub 2019 Feb 25.
25 CAR-T cells beyond CD19, UnCAR-Ted territory.Am J Hematol. 2019 May;94(S1):S34-S41. doi: 10.1002/ajh.25398. Epub 2019 Jan 23.
26 Radiation Priming Chimeric Antigen Receptor T-Cell Therapy in Relapsed/Refractory Diffuse Large B-Cell Lymphoma With High Tumor Burden.J Immunother. 2020 Jan;43(1):32-37. doi: 10.1097/CJI.0000000000000284.
27 T cells redirected against Ig for the immunotherapy of B cell lymphoma.Leukemia. 2020 Mar;34(3):821-830. doi: 10.1038/s41375-019-0607-5. Epub 2019 Oct 17.
28 Combination Therapy with EpCAM-CAR-NK-92 Cells and Regorafenib against Human Colorectal Cancer Models.J Immunol Res. 2018 Oct 15;2018:4263520. doi: 10.1155/2018/4263520. eCollection 2018.
29 Immunotherapy in pediatric B-cell acute lymphoblastic leukemia.Hum Immunol. 2019 Jun;80(6):400-408. doi: 10.1016/j.humimm.2019.01.011. Epub 2019 Feb 1.
30 Switchable CAR-T cells mediate remission in metastatic pancreatic ductal adenocarcinoma.Gut. 2019 Jun;68(6):1052-1064. doi: 10.1136/gutjnl-2018-316595. Epub 2018 Aug 18.
31 Truncation and mutagenesis analysis of the human X-arrestin gene promoter.Gene. 2004 Sep 15;339:139-47. doi: 10.1016/j.gene.2004.06.032.
32 EGFR-specific CAR-T cells trigger cell lysis in EGFR-positive TNBC.Aging (Albany NY). 2019 Dec 4;11(23):11054-11072. doi: 10.18632/aging.102510. Epub 2019 Dec 4.
33 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
34 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
35 cDNA microarray analysis of isogenic paclitaxel- and doxorubicin-resistant breast tumor cell lines reveals distinct drug-specific genetic signatures of resistance. Breast Cancer Res Treat. 2006 Mar;96(1):17-39. doi: 10.1007/s10549-005-9026-6. Epub 2005 Dec 2.