Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSFI0HS)

DOT Name Multiple C2 and transmembrane domain-containing protein 1 (MCTP1)
Gene Name MCTP1
Related Disease
Advanced cancer ( )
Bipolar disorder ( )
UniProt ID
MCTP1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00168 ; PF08372
Sequence
MEPRAAAAGEPEPPAASSSFQARLWKNLQLGVGRSKGGGGGRAGGPERRTADTPSPSPPP
PVGTGNAPARGSGAGSRWSGFKKRKQVLDRVFSSSQPNLCCSSPEPLEPGGAGRAEQGST
LRRRIREHLLPAVKGPAAASGAAGGTPPGGRSPDSAPSSSSASSSLSSSPQPPPRGDRAR
DEGARRQGPGAHLCHQKSSSLPGTACLEQLLEPPPPPAEPARSPAESRAPETGEEHGSSQ
KIINTAGTSNAEVPLADPGMYQLDITLRRGQSLAARDRGGTSDPYVKFKIGGKEVFRSKI
IHKNLNPVWEEKACILVDHLREPLYIKVFDYDFGLQDDFMGSAFLDLTQLELNRPTDVTL
TLKDPHYPDHDLGIILLSVILTPKEGESRDVTMLMRKSWKRSSKELSENEVVGSYFSVKS
LFWRTCGRPALPVLGFCRAELQNPYCKNVQFQTQSLRLSDLHRKSHLWRGIVSITLIEGR
DLKAMDSNGLSDPYVKFRLGHQKYKSKIMPKTLNPQWREQFDFHLYEERGGVIDITAWDK
DAGKRDDFIGRCQVDLSALSREQTHKLELQLEEGEGHLVLLVTLTASATVSISDLSVNSL
EDQKEREEILKRYSPLRIFHNLKDVGFLQVKVIRAEGLMAADVTGKSDPFCVVELNNDRL
LTHTVYKNLNPEWNKVFTFNIKDIHSVLEVTVYDEDRDRSADFLGKVAIPLLSIQNGEQK
AYVLKNKQLTGPTKGVIYLEIDVIFNAVKASLRTLIPKEQKYIEEENRLSKQLLLRNFIR
MKRCVMVLVNAAYYVNSCFDWDSPPRSLAAFVLFLFVVWNFELYMIPLVLLLLLTWNYFL
IISGKDNRQRDTVVEDMLEDEEEEDDKDDKDSEKKGFINKIYAIQEVCVSVQNILDEVAS
FGERIKNTFNWTVPFLSWLAIVALCVFTAILYCIPLRYIVLVWGINKFTKKLRSPYAIDN
NELLDFLSRVPSDVQVVQYQELKPDPSHSPYKRKKNNLG
Function Calcium sensor which is essential for the stabilization of normal baseline neurotransmitter release and for the induction and long-term maintenance of presynaptic homeostatic plasticity.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Genetic Variation [1]
Bipolar disorder DISAM7J2 moderate Genetic Variation [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
NAPQI DM8F5LR Investigative Multiple C2 and transmembrane domain-containing protein 1 (MCTP1) affects the response to substance of NAPQI. [21]
------------------------------------------------------------------------------------
17 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Multiple C2 and transmembrane domain-containing protein 1 (MCTP1). [3]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Multiple C2 and transmembrane domain-containing protein 1 (MCTP1). [4]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Multiple C2 and transmembrane domain-containing protein 1 (MCTP1). [5]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Multiple C2 and transmembrane domain-containing protein 1 (MCTP1). [6]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Multiple C2 and transmembrane domain-containing protein 1 (MCTP1). [7]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Multiple C2 and transmembrane domain-containing protein 1 (MCTP1). [8]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Multiple C2 and transmembrane domain-containing protein 1 (MCTP1). [9]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Multiple C2 and transmembrane domain-containing protein 1 (MCTP1). [10]
Hydroquinone DM6AVR4 Approved Hydroquinone increases the expression of Multiple C2 and transmembrane domain-containing protein 1 (MCTP1). [11]
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate increases the expression of Multiple C2 and transmembrane domain-containing protein 1 (MCTP1). [12]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Multiple C2 and transmembrane domain-containing protein 1 (MCTP1). [13]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Multiple C2 and transmembrane domain-containing protein 1 (MCTP1). [14]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Multiple C2 and transmembrane domain-containing protein 1 (MCTP1). [15]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Multiple C2 and transmembrane domain-containing protein 1 (MCTP1). [16]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Multiple C2 and transmembrane domain-containing protein 1 (MCTP1). [17]
Sulforaphane DMQY3L0 Investigative Sulforaphane increases the expression of Multiple C2 and transmembrane domain-containing protein 1 (MCTP1). [19]
Acetaldehyde DMJFKG4 Investigative Acetaldehyde increases the expression of Multiple C2 and transmembrane domain-containing protein 1 (MCTP1). [20]
------------------------------------------------------------------------------------
⏷ Show the Full List of 17 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Coumarin DM0N8ZM Investigative Coumarin increases the phosphorylation of Multiple C2 and transmembrane domain-containing protein 1 (MCTP1). [18]
------------------------------------------------------------------------------------

References

1 Cancer risk susceptibility loci in a Swedish population.Oncotarget. 2017 Nov 25;8(66):110300-110310. doi: 10.18632/oncotarget.22687. eCollection 2017 Dec 15.
2 Genome-wide association and meta-analysis of bipolar disorder in individuals of European ancestry.Proc Natl Acad Sci U S A. 2009 May 5;106(18):7501-6. doi: 10.1073/pnas.0813386106. Epub 2009 Apr 28.
3 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
4 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
5 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
6 Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
7 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
8 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
9 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
10 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
11 Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
12 CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
13 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
14 Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
15 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
16 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
17 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
18 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
19 Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.
20 Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
21 Acetaminophen-NAPQI hepatotoxicity: a cell line model system genome-wide association study. Toxicol Sci. 2011 Mar;120(1):33-41. doi: 10.1093/toxsci/kfq375. Epub 2010 Dec 22.